StarFunc result for job id Q9H2G2

User Input

>input (1235 residues)
MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLA
AAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM
LELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKN
TRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNP
MRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPI
RELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEEDKLSQNACIL
ESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQM
FENKLIKSEEIKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKD
VISNTSDVIGTCEAADVAQKVDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEV
PIKEIVEMNEIEEGKNKEQAINSSENIMDINEEPGTTEGEEITESSSTEEMEVRSVVADT
DQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVSQPTEPQPVLIPSININSDSG
ENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSKTKDSGSI
SLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRL
RDEAKRIKGEQEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQE
QEFVQKQQQELDGSLKKIIQQQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKH
QLLKQQLKDQYFMQRHQLLKRHEKETEQMQRYNQRLIEELKNRQTQERARLPKIQRSEAK
TRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNERMAQHQKHENQMRDLQLQCEA
NVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQ
EVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08815	0.598	0.612	0.000	1206	0.785	0.803	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
2	AFDB:O54988	0.661	0.662	0.000	1233	0.834	0.835	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
3	AFDB:Q9H2G2	1.000	1.000	0.000	1235	1.000	1.000	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
4	AFDB:F1NBT0	0.576	0.727	3.573E-87	969	0.459	0.585	F1NBT0.pdb.gz	STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus OX=9031 GN=STK10 PE=3 SV=2
5	AFDB:O94804	0.571	0.722	3.573E-87	968	0.459	0.586	O94804.pdb.gz	STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1
6	AFDB:O55098	0.586	0.743	2.450E-84	966	0.447	0.571	O55098.pdb.gz	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
7	AFDB:B7ZR30	0.570	0.733	9.011E-83	950	0.430	0.559	B7ZR30.pdb.gz	STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis OX=8355 GN=stk10-a PE=1 SV=1
8	AFDB:Q9W179	0.526	0.389	9.590E-72	1703	0.360	0.261	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
9	AFDB:A0A0B4LGY8	0.226	0.287	1.181E-30	968	0.138	0.177	A0A0B4LGY8.pdb.gz	A0A0B4LGY8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
10	AFDB:A1ZBH7	0.223	0.227	1.006E-29	1218	0.146	0.148	A1ZBH7.pdb.gz	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
11	PDB:4eomC	0.199	0.825	1.142E-19	276	0.063	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:3eqdA	0.201	0.743	1.267E-19	315	0.072	0.283	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
13	PDB:6byrA	0.203	0.587	7.488E-19	405	0.067	0.205	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:5x3fB	0.198	0.645	8.759E-19	349	0.062	0.221	5x3fB.pdb.gz
15	PDB:4krcA	0.196	0.770	9.228E-19	297	0.067	0.279	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:3c4wB	0.201	0.460	1.820E-18	519	0.061	0.145	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:2yaaA	0.200	0.775	2.624E-18	300	0.077	0.317	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
18	PDB:4yc3A	0.195	0.765	5.452E-18	295	0.064	0.268	4yc3A.pdb.gz
19	PDB:1unlA	0.198	0.788	6.719E-18	292	0.056	0.236	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:8bfsA	0.185	0.737	6.719E-18	274	0.067	0.303	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NBT0	0.0	587	969	0.243	0.310	STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus OX=9031 GN=STK10 PE=3 SV=2
2	O08815	0.0	1855	1206	0.783	0.802	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
3	O54988	0.0	2021	1233	0.840	0.841	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
4	O55098	0.0	560	966	0.231	0.295	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
5	O94804	0.0	561	968	0.245	0.312	STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1
6	Q9H2G2	0.0	2513	1235	1.000	1.000	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
7	B7ZR30	1.48e-167	524	950	0.220	0.286	STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis OX=8355 GN=stk10-a PE=1 SV=1
8	Q8MLP1	5.56e-128	427	1300	0.153	0.145	Q8MLP1_DROME Sterile20-like kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
9	Q7YZB2	1.00e-127	427	1342	0.153	0.141	Q7YZB2_DROME Polo kinase kinase 1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=2 SV=1
10	Q59E61	1.03e-127	427	1342	0.153	0.141	Q59E61_DROME FI24227p1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
11	A4UZU8	1.33e-127	427	1365	0.153	0.138	A4UZU8_DROME Sterile20-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
12	B7YZQ1	4.17e-126	428	1635	0.153	0.116	B7YZQ1_DROME Sterile20-like kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
13	Q9W179	1.31e-125	427	1703	0.153	0.111	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
14	Q95U41	5.14e-78	274	684	0.134	0.241	Q95U41_DROME GH09291p OS=Drosophila melanogaster OX=7227 GN=Slik PE=2 SV=1
15	D4A648	1.79e-77	266	488	0.102	0.258	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
16	Q9JI11	3.67e-77	265	487	0.099	0.251	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
17	Q13043	4.51e-77	265	487	0.099	0.251	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
18	Q7ZUQ3	7.27e-77	265	492	0.100	0.252	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
19	Q9JI10	2.35e-76	263	497	0.100	0.247	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
20	Q13188	1.02e-75	261	491	0.099	0.248	STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	3e-64	228.5	Protein kinase domain
2	PF12474 PKK	1.5e-70	247.2	Polo kinase kinase
3	PF07714 PK_Tyr_Ser-Thr	5.2e-45	165.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311032	0.927	Caspase-3
2	9606.ENSP00000281950	0.905	Gem-associated protein 6
3	9606.ENSP00000300093	0.831	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000288207	0.808	G2/mitotic-specific cyclin-B2
5	9606.ENSP00000378699	0.805	Cyclin-dependent kinase 1
6	9606.ENSP00000287878	0.747	5'-AMP-activated protein kinase subunit gamma-2
7	9606.ENSP00000302100	0.746	Galectin-4
8	9606.ENSP00000238497	0.741	Vacuolar protein sorting-associated protein 4B
9	9606.ENSP00000410758	0.727	U6 snRNA-associated Sm-like protein LSm5
10	9606.ENSP00000249299	0.726	U6 snRNA-associated Sm-like protein LSm8
11	9606.ENSP00000306772	0.704	LIM domain-binding protein 2
12	9606.ENSP00000430432	0.704	Histone deacetylase 2
13	9606.ENSP00000361930	0.681	14-3-3 protein beta/alpha
14	9606.ENSP00000246151	0.679	Promotes megakaryocyte differentiation by up-regulating RUNX1 expression . Regulates RUNX1 expression by activating the proximal promoter of the RUNX1 gene and by enhancing the translation activity of an internal ribosome entry site (IRES) element in the RUNX1 gene
15	9606.ENSP00000340989	0.679	14-3-3 protein sigma
16	9606.ENSP00000171111	0.646	Kelch-like ECH-associated protein 1
17	9606.ENSP00000323867	0.618	5'-AMP-activated protein kinase subunit gamma-1
18	9606.ENSP00000408005	0.618	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
19	9606.ENSP00000418529	0.611	NSFL1 cofactor p47
20	9606.ENSP00000484580	0.611	Protein phosphatase inhibitor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0050839	0.998	cell adhesion molecule binding
GO:0042802	0.929	identical protein binding
GO:0045296	0.912	cadherin binding
GO:0046983	0.849	protein dimerization activity
GO:0042803	0.842	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0050789	0.995	regulation of biological process
GO:0044237	0.995	cellular metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0019538	0.985	protein metabolic process
GO:0036211	0.975	protein modification process
GO:0006793	0.967	phosphorus metabolic process
GO:0006468	0.945	protein phosphorylation
GO:0040012	0.895	regulation of locomotion
GO:2000145	0.839	regulation of cell motility
GO:0071840	0.816	cellular component organization or biogenesis
GO:0016043	0.772	cellular component organization
GO:0051128	0.700	regulation of cellular component organization
GO:0006996	0.651	organelle organization
GO:0048518	0.626	positive regulation of biological process
GO:0046777	0.590	protein autophosphorylation
GO:0048522	0.563	positive regulation of cellular process
GO:0030334	0.533	regulation of cell migration
GO:0007017	0.515	microtubule-based process
GO:0007010	0.456	cytoskeleton organization
GO:0019222	0.427	regulation of metabolic process
GO:0050896	0.423	response to stimulus
GO:0000226	0.392	microtubule cytoskeleton organization
GO:0060255	0.369	regulation of macromolecule metabolic process
GO:0048519	0.344	negative regulation of biological process
GO:0150116	0.337	regulation of cell-substrate junction organization
GO:0051171	0.332	regulation of nitrogen compound metabolic process
GO:0031323	0.329	regulation of cellular metabolic process
GO:0051716	0.320	cellular response to stimulus
GO:0080090	0.310	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0005654	0.961	nucleoplasm
GO:0005576	0.932	extracellular region
GO:0032991	0.890	protein-containing complex
GO:0005615	0.843	extracellular space
GO:0031982	0.809	vesicle
GO:0043230	0.741	extracellular organelle
GO:0070062	0.727	extracellular exosome
GO:0016020	0.436	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]