StarFunc result for job id Q9H2G4

User Input

>input (693 residues)
MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLAD
MRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPT
PEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDER
ESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRL
KRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR
HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDA
SHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE
VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSE
NPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYG
NNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD
RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSED
VWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2G4	0.999	0.999	0.000	693	1.000	1.000	Q9H2G4.pdb.gz	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
2	AFDB:Q63945	0.265	0.619	1.687E-20	289	0.113	0.270	Q63945.pdb.gz	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
3	AFDB:P0DME0	0.257	0.580	6.019E-20	302	0.123	0.281	P0DME0.pdb.gz	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
4	AFDB:A0A2R8QJ70	0.278	0.640	8.148E-20	287	0.117	0.282	A0A2R8QJ70.pdb.gz
5	AFDB:Q8LC68	0.263	0.684	2.904E-18	255	0.113	0.306	Q8LC68.pdb.gz	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
6	AFDB:Q9CA59	0.270	0.696	1.320E-17	256	0.114	0.309	Q9CA59.pdb.gz	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
7	AFDB:Q7JMA9	0.254	0.546	5.003E-17	313	0.123	0.272	Q7JMA9.pdb.gz	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
8	AFDB:A6NKD2	0.237	0.506	1.783E-15	308	0.147	0.331	A6NKD2.pdb.gz	TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens OX=9606 GN=TSPY2 PE=1 SV=1
9	AFDB:Q9R1M3	0.221	0.446	1.097E-14	334	0.131	0.272	Q9R1M3.pdb.gz	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2
10	PDB:7c7xE	0.236	0.914	2.278E-14	174	0.101	0.402	7c7xE.pdb.gz
11	PDB:5gpkB	0.212	0.638	1.165E-10	207	0.071	0.237	5gpkB.pdb.gz
12	PDB:3fs3A	0.230	0.762	3.067E-9	197	0.068	0.239	3fs3A.pdb.gz
13	PDB:2ayuA	0.208	0.466	5.613E-8	283	0.076	0.187	2ayuA.pdb.gz
14	PDB:6n2gA	0.222	0.489	5.613E-8	285	0.061	0.147	6n2gA.pdb.gz
15	PDB:7un6B	0.214	0.554	5.964E-8	240	0.063	0.183	7un6B.pdb.gz
16	PDB:6k09A	0.202	0.471	2.260E-7	267	0.062	0.161	6k09A.pdb.gz
17	PDB:3q66A	0.211	0.534	5.607E-7	236	0.058	0.169	3q66A.pdb.gz
18	PDB:6baqF	0.065	0.139	1.659E-1	211	0.026	0.085	6baqF.pdb.gz
19	AFDB:A0A0R4IAV4	0.080	0.155	2.525E-1	310	0.072	0.161	A0A0R4IAV4.pdb.gz
20	PDB:3w15A	0.056	0.106	3.873E-1	336	0.013	0.027	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H2G4	0.0	1413	693	1.000	1.000	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
2	Q9UJ04	2.46e-76	253	414	0.229	0.384	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
3	Q8N831	6.74e-72	241	410	0.222	0.376	TSYL6_HUMAN Testis-specific Y-encoded-like protein 6 OS=Homo sapiens OX=9606 GN=TSPYL6 PE=1 SV=1
4	Q9H0U9	4.48e-66	226	437	0.152	0.240	TSYL1_HUMAN Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3
5	Q6FI91	1.64e-65	224	438	0.150	0.237	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
6	Q86VY4	1.20e-60	211	417	0.153	0.254	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
7	A6NKD2	1.73e-47	172	308	0.118	0.266	TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens OX=9606 GN=TSPY2 PE=1 SV=1
8	P0CW01	2.48e-47	171	308	0.118	0.266	TSPYA_HUMAN Testis-specific Y-encoded protein 10 OS=Homo sapiens OX=9606 GN=TSPY10 PE=1 SV=2
9	Q01534	8.31e-46	167	308	0.117	0.263	TSPY1_HUMAN Testis-specific Y-encoded protein 1 OS=Homo sapiens OX=9606 GN=TSPY1 PE=1 SV=4
10	Q01105	1.02e-43	160	290	0.108	0.259	SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3
11	Q5VXV3	1.02e-43	160	290	0.108	0.259	Q5VXV3_HUMAN SET OS=Homo sapiens OX=9606 GN=SET PE=2 SV=1
12	Q9EQU5	1.43e-43	160	289	0.108	0.260	SET_MOUSE Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1
13	Q63945	1.81e-43	160	289	0.108	0.260	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
14	Q6TGU0	2.02e-43	159	275	0.110	0.276	Q6TGU0_DANRE Myeloid leukemia-associated SET translocation protein OS=Danio rerio OX=7955 GN=SET PE=1 SV=1
15	P0DME0	7.45e-40	150	302	0.105	0.242	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
16	Q9R1M3	1.09e-39	151	334	0.104	0.216	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2
17	Q9CA59	5.73e-38	144	256	0.110	0.297	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
18	Q8LC68	3.00e-36	139	255	0.113	0.306	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
19	Q18240	4.72e-31	125	312	0.095	0.212	SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=2 SV=2
20	Q7JMA9	1.45e-30	124	313	0.094	0.208	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00956 NAP	1.4e-15	68.8	Nucleosome assembly protein (NAP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.900	X-box-binding protein 1
2	9606.ENSP00000364550	0.797	Lysine-specific demethylase 5C
3	9606.ENSP00000319829	0.789	Zinc finger protein 687
4	9606.ENSP00000282561	0.779	Gap junction alpha-1 protein
5	9606.ENSP00000367408	0.772	Peripheral plasma membrane protein CASK
6	9606.ENSP00000420095	0.744	Protein kinase C-binding protein 1
7	9606.ENSP00000374205	0.727	T-box brain protein 1
8	9606.ENSP00000250863	0.725	Deleted in azoospermia-like
9	9606.ENSP00000357597	0.719	Testis-specific Y-encoded-like protein 1
10	9606.ENSP00000378699	0.639	Cyclin-dependent kinase 1
11	9606.ENSP00000440498	0.624	Ganglioside-induced differentiation-associated protein 1-like 1
12	9606.ENSP00000055335	0.617	Protein phosphatase 1 regulatory subunit 3F
13	9606.ENSP00000417763	0.617	N-alpha-acetyltransferase 10
14	9606.ENSP00000257904	0.605	Cyclin-dependent kinase 4
15	9606.ENSP00000168216	0.604	3-hydroxyacyl-CoA dehydrogenase type-2
16	9606.ENSP00000308717	0.593	Mitochondrial ribosomal protein L48
17	9606.ENSP00000266970	0.579	Cyclin-dependent kinase 2
18	9606.ENSP00000286794	0.572	N-alpha-acetyltransferase 11
19	9606.ENSP00000481495	0.567	ATP-dependent RNA helicase DDX24
20	9606.ENSP00000362616	0.545	Nucleosome assembly protein 1-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0040008	0.994	regulation of growth
GO:0051053	0.989	negative regulation of DNA metabolic process
GO:0051246	0.987	regulation of protein metabolic process
GO:0051338	0.983	regulation of transferase activity
GO:0042325	0.978	regulation of phosphorylation
GO:0031399	0.977	regulation of protein modification process
GO:0001558	0.968	regulation of cell growth
GO:0030308	0.958	negative regulation of cell growth
GO:0006275	0.956	regulation of DNA replication
GO:0001932	0.948	regulation of protein phosphorylation
GO:0045859	0.941	regulation of protein kinase activity
GO:0008156	0.936	negative regulation of DNA replication
GO:0009987	0.677	cellular process
GO:0016043	0.425	cellular component organization
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005730	0.994	nucleolus
GO:0005737	0.908	cytoplasm
GO:0032991	0.757	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]