StarFunc result for job id Q9H2H9

User Input

>input (487 residues)
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2H9	1.000	1.000	3.293E-65	487	1.000	1.000	Q9H2H9.pdb.gz	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
2	AFDB:Q8CFE6	0.832	0.804	2.338E-39	504	0.501	0.484	Q8CFE6.pdb.gz	S38A2_MOUSE Sodium-coupled neutral amino acid symporter 2 OS=Mus musculus OX=10090 GN=Slc38a2 PE=1 SV=1
3	AFDB:A0A024R0W3	0.829	0.798	4.914E-39	506	0.487	0.468	A0A024R0W3.pdb.gz
4	AFDB:Q8R1S9	0.820	0.731	1.905E-38	547	0.493	0.439	Q8R1S9.pdb.gz	S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc38a4 PE=1 SV=1
5	AFDB:Q969I6	0.844	0.753	3.218E-38	547	0.495	0.441	Q969I6.pdb.gz	S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC38A4 PE=1 SV=1
6	AFDB:Q9DCP2	0.844	0.815	2.108E-37	505	0.495	0.477	Q9DCP2.pdb.gz	S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc38a3 PE=1 SV=1
7	AFDB:A2VCW5	0.839	0.853	1.506E-36	479	0.444	0.451	A2VCW5.pdb.gz	S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus OX=10116 GN=Slc38a5 PE=1 SV=1
8	AFDB:Q8WUX1	0.826	0.852	4.116E-36	472	0.444	0.458	Q8WUX1.pdb.gz	S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1
9	AFDB:Q8IZM9	0.809	0.863	1.318E-33	456	0.386	0.412	Q8IZM9.pdb.gz	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
10	AFDB:G3UVW3	0.804	0.856	1.895E-32	457	0.376	0.400	G3UVW3.pdb.gz	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
11	PDB:7kgvB	0.652	0.774	3.165E-12	404	0.142	0.171	7kgvB.pdb.gz
12	PDB:7kgvA	0.594	0.780	5.037E-10	361	0.144	0.194	7kgvA.pdb.gz
13	PDB:7cmhB	0.551	0.582	3.541E-7	458	0.127	0.135	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
14	PDB:7s1xB	0.508	0.313	1.204E-6	871	0.125	0.070	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
15	PDB:6jmqA	0.539	0.633	2.423E-6	403	0.131	0.159	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
16	PDB:7dskB	0.550	0.573	2.531E-6	464	0.113	0.119	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
17	PDB:5j4nA	0.563	0.617	3.015E-6	437	0.113	0.126	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
18	PDB:7p9uB	0.532	0.564	3.751E-6	455	0.115	0.123	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
19	PDB:4djiA	0.561	0.555	1.275E-5	493	0.119	0.118	4djiA.pdb.gz
20	PDB:7ccsB	0.535	0.567	1.658E-5	454	0.136	0.145	7ccsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K2P7	0.0	893	485	0.930	0.934	S38A1_MOUSE Sodium-coupled neutral amino acid symporter 1 OS=Mus musculus OX=10090 GN=Slc38a1 PE=1 SV=1
2	Q9H2H9	0.0	987	487	1.000	1.000	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
3	Q9JM15	0.0	902	485	0.936	0.940	S38A1_RAT Sodium-coupled neutral amino acid symporter 1 OS=Rattus norvegicus OX=10116 GN=Slc38a1 PE=1 SV=1
4	Q8R1S9	1.92e-166	483	547	0.536	0.477	S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc38a4 PE=1 SV=1
5	Q969I6	2.15e-165	480	547	0.528	0.470	S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC38A4 PE=1 SV=1
6	Q9EQ25	4.94e-163	474	547	0.528	0.470	S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus OX=10116 GN=Slc38a4 PE=1 SV=1
7	Q9JHE5	1.84e-160	466	504	0.536	0.518	S38A2_RAT Sodium-coupled neutral amino acid symporter 2 OS=Rattus norvegicus OX=10116 GN=Slc38a2 PE=1 SV=1
8	Q96QD8	3.38e-154	450	506	0.507	0.488	S38A2_HUMAN Sodium-coupled neutral amino acid symporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2
9	Q9DCP2	1.12e-151	444	505	0.478	0.461	S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc38a3 PE=1 SV=1
10	Q99624	7.37e-151	441	504	0.487	0.470	S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC38A3 PE=1 SV=1
11	Q9JHZ9	2.54e-150	440	504	0.476	0.460	S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc38a3 PE=1 SV=1
12	Q8CFE6	3.86e-147	432	504	0.505	0.488	S38A2_MOUSE Sodium-coupled neutral amino acid symporter 2 OS=Mus musculus OX=10090 GN=Slc38a2 PE=1 SV=1
13	Q8WUX1	5.57e-120	361	472	0.462	0.477	S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1
14	A2VCW5	5.14e-117	354	479	0.450	0.457	S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus OX=10116 GN=Slc38a5 PE=1 SV=1
15	Q3U1J0	7.76e-116	351	479	0.450	0.457	S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus OX=10090 GN=Slc38a5 PE=1 SV=1
16	Q8IZM9	5.40e-109	333	456	0.390	0.417	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
17	G3UVW3	3.12e-107	328	457	0.384	0.409	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
18	F8VQW8	3.93e-99	303	344	0.347	0.491	F8VQW8_HUMAN Solute carrier family 38 member 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=1
19	Q9LI61	9.77e-33	132	460	0.255	0.270	AVT6A_ARATH Amino acid transporter AVT6A OS=Arabidopsis thaliana OX=3702 GN=AVT6A PE=2 SV=1
20	Q57V86	7.19e-31	126	466	0.195	0.204	Q57V86_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.170 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	1.2e-75	266.4	Transmembrane amino acid transporter protein
2	PF00689 Cation_ATPase_C	19	16.4	Cation transporting ATPase, C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000005062

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000005063	0.812	Solute carrier family 38, member 2
2	9601.ENSPPYP00000011364	0.710	Solute carrier family 1 (neutral amino acid transporter), member 5
3	9601.ENSPPYP00000020154	0.696	GRIP and coiled-coil domain containing 1
4	9601.ENSPPYP00000013533	0.652	GRIP and coiled-coil domain containing 2
5	9601.ENSPPYP00000015662	0.587	Sodium channel, voltage-gated, type XI, alpha subunit
6	9601.ENSPPYP00000013785	0.582	Amino acid transporter
7	9601.ENSPPYP00000001556	0.580	Amino acid transporter
8	9601.ENSPPYP00000008611	0.558	Solute carrier family 7 (amino acid transporter light chain, L system), member 5
9	9601.ENSPPYP00000009726	0.557	Aralkylamine N-acetyltransferase
10	9601.ENSPPYP00000000848	0.533	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
11	9601.ENSPPYP00000018435	0.527	PBX homeobox 2
12	9601.ENSPPYP00000004168	0.522	Ragulator complex protein LAMTOR1
13	9601.ENSPPYP00000021363	0.518	Uncharacterized protein DKFZp468E2122
14	9601.ENSPPYP00000001218	0.513	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
15	9601.ENSPPYP00000009800	0.508	Putative sodium-coupled neutral amino acid transporter 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015179	0.999	L-amino acid transmembrane transporter activity
GO:0015175	0.999	neutral L-amino acid transmembrane transporter activity
GO:0015318	0.997	inorganic molecular entity transmembrane transporter activity
GO:0008324	0.996	monoatomic cation transmembrane transporter activity
GO:0015291	0.995	secondary active transmembrane transporter activity
GO:0022890	0.992	inorganic cation transmembrane transporter activity
GO:0022853	0.988	active monoatomic ion transmembrane transporter activity
GO:1901702	0.987	salt transmembrane transporter activity
GO:0005515	0.969	protein binding
GO:0015081	0.964	sodium ion transmembrane transporter activity
GO:0015293	0.892	symporter activity
GO:0015186	0.873	L-glutamine transmembrane transporter activity
GO:0005416	0.561	amino acid:monoatomic cation symporter activity
GO:0015370	0.446	solute:sodium symporter activity
GO:0005343	0.356	organic acid:sodium symporter activity
GO:0005283	0.329	amino acid:sodium symporter activity
GO:0022858	0.306	alanine transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.996	localization
GO:0006810	0.992	transport
GO:0006865	0.966	amino acid transport
GO:0065007	0.942	biological regulation
GO:0009987	0.809	cellular process
GO:0015804	0.770	neutral amino acid transport
GO:0050789	0.403	regulation of biological process
GO:0050794	0.355	regulation of cellular process
GO:1905039	0.344	carboxylic acid transmembrane transport
GO:0003333	0.331	amino acid transmembrane transport
GO:0065008	0.305	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098590	0.931	plasma membrane region
GO:0043227	0.477	membrane-bounded organelle
GO:0031982	0.426	vesicle
GO:0005622	0.323	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.964	Na(+)(in) = Na(+)(out)

[back to server]