StarFunc result for job id Q9H2J4

User Input

>input (239 residues)
MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHE
DEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLY
KQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIG
PLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2J4	1.000	1.000	1.808E-48	239	1.000	1.000	Q9H2J4.pdb.gz	PDCL3_HUMAN Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1
2	AFDB:Q4KLJ8	0.720	0.717	4.547E-42	240	0.883	0.879	Q4KLJ8.pdb.gz	PDCL3_RAT Phosducin-like protein 3 OS=Rattus norvegicus OX=10116 GN=Pdcl3 PE=1 SV=1
3	AFDB:Q6P268	0.797	0.797	1.171E-39	239	0.724	0.724	Q6P268.pdb.gz	PDCL3_DANRE Phosducin-like protein 3 OS=Danio rerio OX=7955 GN=pdcl3 PE=2 SV=1
4	PDB:7nvmP	0.574	0.712	6.183E-32	190	0.795	1.000	7nvmP.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
5	AFDB:Q71A38	0.603	0.603	7.724E-23	239	0.385	0.385	Q71A38.pdb.gz	PHLP2_DICDI Phosducin-like protein 2 OS=Dictyostelium discoideum OX=44689 GN=phlp2 PE=2 SV=2
6	AFDB:Q12017	0.507	0.429	3.894E-19	286	0.293	0.245	Q12017.pdb.gz	PLP2_YEAST Phosducin-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLP2 PE=1 SV=1
7	AFDB:Q385S5	0.591	0.582	1.145E-16	243	0.268	0.263	Q385S5.pdb.gz	Q385S5_TRYB2 Phosducin thioredoxin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2540 PE=3 SV=1
8	AFDB:Q71A39	0.475	0.363	2.264E-14	316	0.272	0.206	Q71A39.pdb.gz	PHLP1_DICDI Phosducin-like protein 1 OS=Dictyostelium discoideum OX=44689 GN=phlp1 PE=2 SV=1
9	AFDB:Q6NPL9	0.512	0.530	5.831E-12	230	0.222	0.230	Q6NPL9.pdb.gz	PLP3A_ARATH Thioredoxin domain-containing protein PLP3A OS=Arabidopsis thaliana OX=3702 GN=PLP3A PE=1 SV=1
10	AFDB:O14530	0.537	0.566	5.163E-11	226	0.197	0.208	O14530.pdb.gz	TXND9_HUMAN Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2
11	AFDB:Q9CQ79	0.543	0.571	1.391E-10	226	0.197	0.208	Q9CQ79.pdb.gz	TXND9_MOUSE Thioredoxin domain-containing protein 9 OS=Mus musculus OX=10090 GN=Txndc9 PE=1 SV=1
12	PDB:6lurD	0.377	0.419	6.106E-8	213	0.100	0.113	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
13	PDB:6yt3B	0.322	0.210	2.446E-7	376	0.079	0.051	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
14	PDB:5xocB	0.383	0.656	2.792E-7	133	0.105	0.188	5xocB.pdb.gz
15	PDB:6gd1A	0.373	0.462	8.037E-7	190	0.075	0.095	6gd1A.pdb.gz
16	PDB:7scdA	0.370	0.244	8.037E-7	371	0.075	0.049	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
17	PDB:6iblA	0.384	0.236	1.047E-6	397	0.075	0.045	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
18	PDB:3f3qA	0.365	0.749	2.472E-6	109	0.054	0.119	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
19	PDB:6z7oA	0.363	0.722	3.926E-6	110	0.105	0.227	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
20	PDB:4pufC	0.371	0.739	5.114E-6	112	0.092	0.196	4pufC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H2J4	2.63e-177	488	239	1.000	1.000	PDCL3_HUMAN Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1
2	Q4KLJ8	3.19e-144	404	240	0.887	0.883	PDCL3_RAT Phosducin-like protein 3 OS=Rattus norvegicus OX=10116 GN=Pdcl3 PE=1 SV=1
3	Q8BVF2	1.08e-132	375	240	0.891	0.887	PDCL3_MOUSE Phosducin-like protein 3 OS=Mus musculus OX=10090 GN=Pdcl3 PE=1 SV=1
4	Q6P268	3.32e-116	333	239	0.732	0.732	PDCL3_DANRE Phosducin-like protein 3 OS=Danio rerio OX=7955 GN=pdcl3 PE=2 SV=1
5	Q71A38	1.55e-38	135	239	0.276	0.276	PHLP2_DICDI Phosducin-like protein 2 OS=Dictyostelium discoideum OX=44689 GN=phlp2 PE=2 SV=2
6	Q12017	1.33e-20	90.1	286	0.289	0.241	PLP2_YEAST Phosducin-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLP2 PE=1 SV=1
7	Q71A39	4.50e-18	83.6	316	0.192	0.146	PHLP1_DICDI Phosducin-like protein 1 OS=Dictyostelium discoideum OX=44689 GN=phlp1 PE=2 SV=1
8	Q385S5	7.03e-18	81.6	243	0.167	0.165	Q385S5_TRYB2 Phosducin thioredoxin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2540 PE=3 SV=1
9	Q13371	8.90e-14	71.2	301	0.255	0.203	PHLP_HUMAN Phosducin-like protein OS=Homo sapiens OX=9606 GN=PDCL PE=1 SV=3
10	Q9DBX2	2.67e-13	70.1	301	0.251	0.199	PHLP_MOUSE Phosducin-like protein OS=Mus musculus OX=10090 GN=Pdcl PE=1 SV=1
11	Q63737	3.47e-13	69.7	301	0.255	0.203	PHLP_RAT Phosducin-like protein OS=Rattus norvegicus OX=10116 GN=Pdcl PE=1 SV=1
12	P20941	1.09e-10	62.0	246	0.197	0.191	PHOS_HUMAN Phosducin OS=Homo sapiens OX=9606 GN=PDC PE=1 SV=1
13	Q9QW08	4.95e-10	60.1	244	0.163	0.160	PHOS_MOUSE Phosducin OS=Mus musculus OX=10090 GN=Pdc PE=2 SV=1
14	Q8LCV1	5.94e-07	51.2	230	0.180	0.187	PLP3B_ARATH Thioredoxin domain-containing protein PLP3B OS=Arabidopsis thaliana OX=3702 GN=PLP3B PE=2 SV=1
15	O14530	7.37e-07	50.8	226	0.218	0.230	TXND9_HUMAN Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2
16	Q9CQ79	8.42e-07	50.4	226	0.201	0.212	TXND9_MOUSE Thioredoxin domain-containing protein 9 OS=Mus musculus OX=10090 GN=Txndc9 PE=1 SV=1
17	Q6NPL9	1.82e-05	46.6	230	0.117	0.122	PLP3A_ARATH Thioredoxin domain-containing protein PLP3A OS=Arabidopsis thaliana OX=3702 GN=PLP3A PE=1 SV=1
18	Q04004	4.04e-05	45.8	230	0.201	0.209	PLP1_YEAST Phosducin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLP1 PE=1 SV=1
19	B8ZZX4	4.15e-04	41.6	135	0.134	0.237	B8ZZX4_HUMAN Thioredoxin domain containing 9 (Fragment) OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=1
20	O14095	0.002	40.8	279	0.163	0.140	PLP1_SCHPO Thioredoxin domain-containing protein plp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	76	15.3	Calcitonin / CGRP / IAPP family
2	PF02604 PhdYeFM_antitox	1.1e+02	14.1	Antitoxin Phd_YefM, type II toxin-antitoxin system
3	PF02114 Phosducin	3.5e-13	60.7	Phosducin
4	PF03683 UPF0175	8	17.6	Uncharacterised protein family (UPF0175)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295688	0.942	T-complex protein 1 subunit gamma
2	9606.ENSP00000377958	0.913	T-complex protein 1 subunit delta
3	9606.ENSP00000258091	0.904	T-complex protein 1 subunit eta
4	9606.ENSP00000275603	0.874	T-complex protein 1 subunit zeta
5	9606.ENSP00000317334	0.869	T-complex protein 1 subunit alpha
6	9606.ENSP00000286788	0.845	T-complex protein 1 subunit theta
7	9606.ENSP00000365505	0.822	Proteolipid protein 2
8	9606.ENSP00000360242	0.782	E3 ubiquitin-protein ligase XIAP
9	9606.ENSP00000289228	0.709	Beta-centractin
10	9606.ENSP00000327533	0.706	Lysozyme g-like protein 2
11	9606.ENSP00000407761	0.704	Acyl-coenzyme A oxidase-like protein
12	9606.ENSP00000315680	0.676	Peroxisomal targeting signal 2 receptor
13	9606.ENSP00000340823	0.675	General transcription factor IIF subunit 2
14	9606.ENSP00000359149	0.675	F-box/WD repeat-containing protein 4
15	9606.ENSP00000263923	0.662	Vascular endothelial growth factor receptor 2
16	9606.ENSP00000354777	0.658	TANK-binding kinase 1-binding protein 1
17	9606.ENSP00000318944	0.650	E3 ubiquitin-protein ligase TRAF7
18	9606.ENSP00000339001	0.646	Tubulin beta chain
19	9606.ENSP00000345412	0.644	Cleavage and polyadenylation specificity factor subunit 7
20	9606.ENSP00000369703	0.644	Tubulin beta-2A chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044183	1.000	protein folding chaperone
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0006457	0.962	protein folding
GO:0050794	0.878	regulation of cellular process
GO:0032501	0.867	multicellular organismal process
GO:0032502	0.855	developmental process
GO:0010468	0.764	regulation of gene expression
GO:0001944	0.758	vasculature development
GO:0035239	0.736	tube morphogenesis
GO:0048514	0.721	blood vessel morphogenesis
GO:0001525	0.689	angiogenesis
GO:0010628	0.605	positive regulation of gene expression
GO:0031647	0.483	regulation of protein stability
GO:0080090	0.460	regulation of primary metabolic process
GO:0051171	0.446	regulation of nitrogen compound metabolic process
GO:0048522	0.418	positive regulation of cellular process
GO:0031323	0.416	regulation of cellular metabolic process
GO:0050896	0.361	response to stimulus
GO:0051173	0.333	positive regulation of nitrogen compound metabolic process
GO:0071840	0.307	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0012505	0.991	endomembrane system
GO:0032991	0.705	protein-containing complex
GO:0005783	0.641	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]