StarFunc result for job id Q9H2K2

User Input

>input (1166 residues)
MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIMRPEGMVDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IYN3	0.393	0.360	0.000	1274	0.800	0.732	A0A0R4IYN3.pdb.gz	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
2	AFDB:O95271	0.404	0.356	0.000	1327	0.815	0.716	O95271.pdb.gz	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
3	AFDB:Q3UES3	0.419	0.419	0.000	1166	0.972	0.972	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
4	AFDB:Q9VBP3	0.380	0.375	0.000	1181	0.647	0.638	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
5	AFDB:G5E8K5	0.173	0.116	1.288E-37	1961	0.250	0.148	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
6	AFDB:Q0KIE7	0.165	0.137	1.337E-37	1549	0.208	0.156	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
7	AFDB:P97582	0.151	0.187	5.492E-37	843	0.217	0.300	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
8	AFDB:Q9NCP8	0.163	0.164	6.140E-37	1159	0.227	0.229	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	PDB:8cs9A	0.167	0.225	1.369E-36	796	0.201	0.294	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
10	AFDB:P16157	0.167	0.115	1.676E-36	1881	0.212	0.131	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
11	AFDB:O70511	0.161	0.090	2.717E-36	2622	0.226	0.101	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
12	PDB:5vkqA	0.154	0.128	4.645E-25	1499	0.186	0.145	5vkqA.pdb.gz
13	PDB:2dvwA	0.106	0.520	1.650E-10	229	0.064	0.328	2dvwA.pdb.gz
14	PDB:4oauC	0.090	0.138	1.650E-10	692	0.084	0.142	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:1wg0A	0.099	0.452	3.613E-9	243	0.064	0.309	1wg0A.pdb.gz
16	PDB:6v9hC	0.101	0.417	4.204E-8	270	0.060	0.259	6v9hC.pdb.gz
17	PDB:6aunA	0.111	0.196	1.434E-7	618	0.065	0.123	6aunA.pdb.gz
18	PDB:6mwqA	0.129	0.294	6.116E-7	493	0.093	0.221	6mwqA.pdb.gz
19	PDB:6pqpA	0.121	0.221	1.335E-6	615	0.078	0.148	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6jd6B	0.122	0.708	3.926E-6	192	0.041	0.250	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IYN3	0.0	1951	1274	0.803	0.735	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
2	A0A8I5YBL7	0.0	1959	1313	0.802	0.712	A0A8I5YBL7_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
3	A3KGU1	0.0	1957	1267	0.803	0.739	A3KGU1_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=LOC567533 PE=2 SV=1
4	D3Z8Q6	0.0	1989	1317	0.810	0.717	D3Z8Q6_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
5	E7EWY6	0.0	731	617	0.297	0.561	E7EWY6_HUMAN Tankyrase OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=1
6	O95271	0.0	1995	1327	0.811	0.713	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
7	Q3UES3	0.0	2356	1166	0.973	0.973	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
8	Q6PFX9	0.0	1991	1320	0.810	0.716	TNKS1_MOUSE Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1
9	Q9H2K2	0.0	2407	1166	1.000	1.000	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1
10	Q9VBP3	0.0	1530	1181	0.647	0.638	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
11	G5E8K5	8.46e-85	306	1961	0.218	0.130	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
12	Q12955	8.70e-85	306	4377	0.218	0.058	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
13	A0A5F9ZHQ3	2.55e-84	304	1838	0.224	0.142	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHN0	3.11e-84	304	1777	0.224	0.147	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	O70511	4.53e-84	304	2622	0.222	0.099	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
16	O88521	4.14e-83	300	1762	0.214	0.142	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
17	A0A5F9ZI08	8.50e-83	300	1797	0.226	0.146	A0A5F9ZI08_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH03	8.56e-83	300	1785	0.226	0.147	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZI36	8.99e-83	300	1846	0.226	0.142	A0A5F9ZI36_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHE2	1.20e-82	299	1806	0.226	0.146	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	8.5e-103	344.2	Ankyrin repeat
2	PF12796 Ank_2	5.3e-105	355.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.1e-91	299.0	Ankyrin repeat
4	PF13637 Ank_4	5.6e-100	337.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.8e-104	350.4	Ankyrin repeats (many copies)
6	PF00644 PARP	1.1e-21	88.8	Poly(ADP-ribose) polymerase catalytic domain
7	PF00536 SAM_1	3.4e-07	41.9	SAM domain (Sterile alpha motif)
8	PF07647 SAM_2	4.2e-10	50.9	SAM domain (Sterile alpha motif)
9	PF10366 Vps39_1	12	17.6	Vacuolar sorting protein 39 domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276603	0.987	Telomeric repeat-binding factor 1
2	9606.ENSP00000262320	0.978	Axin-1
3	9606.ENSP00000422168	0.973	SH3 domain-binding protein 2
4	9606.ENSP00000231368	0.965	Leucyl-cystinyl aminopeptidase
5	9606.ENSP00000361021	0.959	Phosphatase and tensin homolog
6	9606.ENSP00000299163	0.948	Hypoxia-inducible factor 1-alpha inhibitor
7	9606.ENSP00000357297	0.944	E3 ubiquitin-protein ligase RNF146
8	9606.ENSP00000302625	0.935	Axin-2
9	9606.ENSP00000350075	0.932	Arpin
10	9606.ENSP00000381577	0.930	Ubiquitin carboxyl-terminal hydrolase 34
11	9606.ENSP00000311579	0.921	Tankyrase-1
12	9606.ENSP00000272317	0.910	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000304697	0.910	Polyubiquitin-B
14	9606.ENSP00000441543	0.910	Polyubiquitin-C
15	9606.ENSP00000388107	0.907	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000352408	0.905	BRISC and BRCA1-A complex member 1
17	9606.ENSP00000456348	0.870	poly(ADP-ribose) polymerase family member 6
18	9606.ENSP00000437271	0.811	182 kDa tankyrase-1-binding protein
19	9606.ENSP00000381377	0.806	C15orf38-AP3S2 readthrough
20	9606.ENSP00000281631	0.795	poly(ADP-ribose) polymerase family member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003950	0.999	NAD+ ADP-ribosyltransferase activity
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0019899	0.995	enzyme binding
GO:1990404	0.987	NAD+-protein ADP-ribosyltransferase activity
GO:0042393	0.445	histone binding
GO:0008270	0.365	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.984	cellular process
GO:0050789	0.983	regulation of biological process
GO:0071704	0.980	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0048518	0.958	positive regulation of biological process
GO:0043170	0.958	macromolecule metabolic process
GO:0019222	0.958	regulation of metabolic process
GO:0050794	0.952	regulation of cellular process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0048522	0.924	positive regulation of cellular process
GO:0080090	0.916	regulation of primary metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:0031323	0.903	regulation of cellular metabolic process
GO:0048519	0.902	negative regulation of biological process
GO:0033044	0.859	regulation of chromosome organization
GO:0051052	0.829	regulation of DNA metabolic process
GO:1901564	0.803	organonitrogen compound metabolic process
GO:2000278	0.795	regulation of DNA biosynthetic process
GO:0032204	0.788	regulation of telomere maintenance
GO:0019538	0.779	protein metabolic process
GO:0034502	0.775	protein localization to chromosome
GO:0043412	0.769	macromolecule modification
GO:0048583	0.755	regulation of response to stimulus
GO:0036211	0.731	protein modification process
GO:0048523	0.713	negative regulation of cellular process
GO:0032502	0.708	developmental process
GO:0032501	0.707	multicellular organismal process
GO:0010604	0.705	positive regulation of macromolecule metabolic process
GO:0051173	0.690	positive regulation of nitrogen compound metabolic process
GO:0031325	0.685	positive regulation of cellular metabolic process
GO:1904356	0.681	regulation of telomere maintenance via telomere lengthening
GO:0050896	0.676	response to stimulus
GO:0051054	0.619	positive regulation of DNA metabolic process
GO:0032210	0.555	regulation of telomere maintenance via telomerase
GO:0043687	0.534	post-translational protein modification
GO:0051130	0.526	positive regulation of cellular component organization
GO:0044237	0.522	cellular metabolic process
GO:2001252	0.486	positive regulation of chromosome organization
GO:0051716	0.478	cellular response to stimulus
GO:0023051	0.456	regulation of signaling
GO:0010646	0.456	regulation of cell communication
GO:0009966	0.445	regulation of signal transduction
GO:0071840	0.435	cellular component organization or biogenesis
GO:0016043	0.405	cellular component organization
GO:0048584	0.386	positive regulation of response to stimulus
GO:0010639	0.327	negative regulation of organelle organization
GO:0009892	0.326	negative regulation of metabolic process
GO:0010468	0.307	regulation of gene expression
GO:2000573	0.302	positive regulation of DNA biosynthetic process
GO:0040007	0.300	growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.999	cytosol
GO:0005634	0.977	nucleus
GO:0043228	0.963	non-membrane-bounded organelle
GO:0005654	0.955	nucleoplasm
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0012505	0.933	endomembrane system
GO:0016020	0.576	membrane
GO:0005856	0.555	cytoskeleton
GO:0005694	0.459	chromosome
GO:0032991	0.344	protein-containing complex
GO:0031967	0.315	organelle envelope
GO:0098687	0.310	chromosomal region
GO:0005813	0.307	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	0.999	NAD(+) ADP-ribosyltransferase.

[back to server]