StarFunc result for job id Q9H2K8

User Input

>input (898 residues)
MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGK
QTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQ
EVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVG
TPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPT
LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAVREL
DNLQYRKMKKILFQETRNGPLNESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQ
SSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQ
SVQSQALHYRNRERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALEN
KLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQ
QKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHL
LTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELE
YRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIK
KQFQDTCKVQTKQYKALKNHQLEVTPKNEHKTILKTLKDEQTRKLAILAEQYEQSINEMM
ASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRA
HLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2K8	1.000	1.000	0.000	898	1.000	1.000	Q9H2K8.pdb.gz	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
2	AFDB:O88664	0.863	0.777	1.300E-98	1001	0.732	0.656	O88664.pdb.gz	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
3	AFDB:X1WD79	0.664	0.541	7.124E-91	1138	0.673	0.531	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
4	AFDB:A0A0R4IIN0	0.783	0.635	2.673E-89	1121	0.686	0.550	A0A0R4IIN0.pdb.gz	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
5	AFDB:Q0KHQ5	0.702	0.616	1.046E-75	1039	0.537	0.464	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
6	AFDB:Q6ZQ29	0.357	0.265	8.622E-68	1240	0.524	0.380	Q6ZQ29.pdb.gz	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
7	AFDB:P46549	0.747	0.689	1.658E-65	982	0.394	0.360	P46549.pdb.gz	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
8	AFDB:Q499L9	0.304	0.642	1.067E-28	416	0.149	0.322	Q499L9.pdb.gz	Q499L9_HUMAN Serine/threonine protein kinase MST4 OS=Homo sapiens OX=9606 GN=MST4 PE=1 SV=1
9	AFDB:O24527	0.308	0.331	1.117E-27	836	0.164	0.176	O24527.pdb.gz	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
10	AFDB:D4A648	0.305	0.547	1.295E-26	487	0.159	0.294	D4A648.pdb.gz	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
11	PDB:4eomC	0.267	0.815	7.004E-18	276	0.087	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:5u6yA	0.264	0.500	1.001E-17	459	0.079	0.155	5u6yA.pdb.gz
13	PDB:3c4wB	0.276	0.468	1.935E-16	519	0.071	0.123	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:3eqdA	0.273	0.746	1.935E-16	315	0.089	0.254	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
15	PDB:5x3fB	0.264	0.638	2.036E-16	349	0.070	0.181	5x3fB.pdb.gz
16	PDB:2yaaA	0.278	0.789	2.143E-16	300	0.079	0.237	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:1unlA	0.267	0.775	2.255E-16	292	0.076	0.233	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:4yc3A	0.255	0.730	2.255E-16	295	0.076	0.231	4yc3A.pdb.gz
19	PDB:4krcA	0.262	0.758	2.628E-16	297	0.075	0.226	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:6b1uA	0.268	0.527	3.393E-16	442	0.076	0.154	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IIN0	0.0	1209	1121	0.695	0.557	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
2	E1BHE1	0.0	1762	874	0.954	0.981	E1BHE1_BOVIN TAO kinase 3 OS=Bos taurus OX=9913 GN=TAOK3 PE=4 SV=2
3	O88664	0.0	1284	1001	0.737	0.661	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
4	P46549	0.0	591	982	0.399	0.365	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
5	Q5F2E8	0.0	1286	1001	0.736	0.660	TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus OX=10090 GN=Taok1 PE=1 SV=1
6	Q6ZQ29	0.0	920	1240	0.527	0.381	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
7	Q7L7X3	0.0	1288	1001	0.737	0.661	TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1
8	Q9H2K8	0.0	1855	898	1.000	1.000	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
9	Q9JLS3	0.0	910	1235	0.527	0.383	TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus OX=10116 GN=Taok2 PE=1 SV=1
10	Q9UL54	0.0	904	1235	0.520	0.378	TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens OX=9606 GN=TAOK2 PE=1 SV=2
11	X1WD79	0.0	1209	1138	0.679	0.536	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
12	Q0KHQ5	1.07e-175	538	1039	0.275	0.238	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
13	Q13043	8.79e-73	249	487	0.141	0.261	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
14	Q9JI11	3.50e-72	248	487	0.140	0.259	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
15	O24527	5.02e-72	256	836	0.144	0.154	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
16	D4A648	2.99e-71	245	488	0.140	0.258	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
17	Q9JI10	4.95e-71	245	497	0.138	0.249	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
18	Q13188	7.05e-71	244	491	0.138	0.253	STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2
19	O61125	1.68e-70	243	461	0.136	0.265	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
20	Q7ZUQ3	4.80e-70	242	492	0.138	0.252	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	6.9	18.0	Phosphotransferase enzyme family
2	PF00069 Pkinase	5.1e-60	214.7	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	2.8e-40	149.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278616	0.929	Serine-protein kinase ATM
2	9606.ENSP00000345083	0.913	Dual specificity mitogen-activated protein kinase kinase 3
3	9606.ENSP00000468348	0.913	Dual specificity mitogen-activated protein kinase kinase 6
4	9606.ENSP00000261716	0.903	Serine/threonine-protein kinase TAO1
5	9606.ENSP00000310094	0.902	Serine/threonine-protein kinase TAO2
6	9606.ENSP00000398744	0.704	Adenosine deaminase-like protein
7	9606.ENSP00000482609	0.703	Peroxisome assembly protein 12
8	9606.ENSP00000272462	0.621	MAL-like protein
9	9606.ENSP00000083182	0.620	Amyloid protein-binding protein 2
10	9606.ENSP00000380904	0.586	DNA-directed RNA polymerase III subunit RPC4
11	9606.ENSP00000478927	0.557	Transcriptional coactivator YAP1
12	9606.ENSP00000361965	0.548	Adenosine deaminase
13	9606.ENSP00000338727	0.525	Leucine-rich repeat flightless-interacting protein 2
14	9606.ENSP00000460885	0.510	Belongs to the WD repeat coronin family.
15	9606.ENSP00000422338	0.505	Protein FAM173B
16	9606.ENSP00000251166	0.504	Coronin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019887	0.997	protein kinase regulator activity
GO:0019210	0.518	kinase inhibitor activity
GO:0004860	0.506	protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.981	response to stimulus
GO:0050794	0.981	regulation of cellular process
GO:0044237	0.977	cellular metabolic process
GO:0019222	0.959	regulation of metabolic process
GO:0048518	0.941	positive regulation of biological process
GO:0071704	0.933	organic substance metabolic process
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0051716	0.924	cellular response to stimulus
GO:0048519	0.924	negative regulation of biological process
GO:0044238	0.916	primary metabolic process
GO:0080090	0.911	regulation of primary metabolic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0048523	0.898	negative regulation of cellular process
GO:0016310	0.895	phosphorylation
GO:0048522	0.891	positive regulation of cellular process
GO:0006950	0.885	response to stress
GO:0048583	0.867	regulation of response to stimulus
GO:0031323	0.854	regulation of cellular metabolic process
GO:0006807	0.848	nitrogen compound metabolic process
GO:0043408	0.848	regulation of MAPK cascade
GO:0010564	0.836	regulation of cell cycle process
GO:0006974	0.832	cellular response to DNA damage stimulus
GO:0007165	0.832	signal transduction
GO:0043170	0.831	macromolecule metabolic process
GO:0042770	0.821	signal transduction in response to DNA damage
GO:0019220	0.815	regulation of phosphate metabolic process
GO:0031399	0.815	regulation of protein modification process
GO:0006468	0.810	protein phosphorylation
GO:0007346	0.807	regulation of mitotic cell cycle
GO:0080135	0.805	regulation of cellular response to stress
GO:0044774	0.804	mitotic DNA integrity checkpoint signaling
GO:1902533	0.789	positive regulation of intracellular signal transduction
GO:0001932	0.785	regulation of protein phosphorylation
GO:0043410	0.767	positive regulation of MAPK cascade
GO:1901990	0.757	regulation of mitotic cell cycle phase transition
GO:0044818	0.754	mitotic G2/M transition checkpoint
GO:0010604	0.735	positive regulation of macromolecule metabolic process
GO:0051173	0.723	positive regulation of nitrogen compound metabolic process
GO:0051247	0.700	positive regulation of protein metabolic process
GO:0065009	0.697	regulation of molecular function
GO:0044773	0.669	mitotic DNA damage checkpoint signaling
GO:0045859	0.647	regulation of protein kinase activity
GO:0070302	0.630	regulation of stress-activated protein kinase signaling cascade
GO:0007095	0.613	mitotic G2 DNA damage checkpoint signaling
GO:0032872	0.601	regulation of stress-activated MAPK cascade
GO:0031401	0.597	positive regulation of protein modification process
GO:0070304	0.570	positive regulation of stress-activated protein kinase signaling cascade
GO:0031325	0.533	positive regulation of cellular metabolic process
GO:0071900	0.507	regulation of protein serine/threonine kinase activity
GO:0043405	0.502	regulation of MAP kinase activity
GO:0032874	0.488	positive regulation of stress-activated MAPK cascade
GO:0032501	0.452	multicellular organismal process
GO:0042327	0.435	positive regulation of phosphorylation
GO:0044093	0.384	positive regulation of molecular function
GO:0032502	0.325	developmental process
GO:0048856	0.323	anatomical structure development
GO:0043085	0.317	positive regulation of catalytic activity
GO:0046328	0.312	regulation of JNK cascade
GO:0046777	0.311	protein autophosphorylation
GO:0000165	0.303	MAPK cascade
GO:0009968	0.301	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.996	organelle
GO:0043229	0.989	intracellular organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005829	0.974	cytosol
GO:0043227	0.950	membrane-bounded organelle
GO:0031982	0.721	vesicle
GO:0016020	0.683	membrane
GO:0043231	0.457	intracellular membrane-bounded organelle
GO:0071944	0.422	cell periphery
GO:0005856	0.344	cytoskeleton
GO:0015630	0.306	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]