StarFunc result for job id Q9H2L5

User Input

>input (321 residues)
MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIA
WGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESS
TDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSV
FTPAYGSVTNVRVNSTMTTLQVLTLLLNKFRVEDGPSEFALYIVHESGERTKLKDCEYPL
ISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPVLDSFVEKLKEEEEREIIKLT
MKFQALRLTMLQRLEQLVEAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2L5	1.000	1.000	2.355E-59	321	1.000	1.000	Q9H2L5.pdb.gz	RASF4_HUMAN Ras association domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RASSF4 PE=1 SV=2
2	AFDB:P50749	0.685	0.675	6.216E-39	326	0.579	0.571	P50749.pdb.gz	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
3	AFDB:Q80UQ2	0.675	0.617	8.408E-30	353	0.374	0.340	Q80UQ2.pdb.gz	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
4	AFDB:Q6ZTQ3	0.639	0.563	2.065E-29	369	0.368	0.320	Q6ZTQ3.pdb.gz	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
5	AFDB:Q9VCQ7	0.434	0.181	1.300E-16	806	0.265	0.105	Q9VCQ7.pdb.gz	Q9VCQ7_DROME LD40758p OS=Drosophila melanogaster OX=7227 GN=Rassf PE=1 SV=3
6	AFDB:Q9NS23	0.386	0.361	1.954E-11	344	0.187	0.174	Q9NS23.pdb.gz	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
7	AFDB:Q68FW0	0.371	0.436	2.972E-11	270	0.193	0.230	Q68FW0.pdb.gz
8	AFDB:Q8WWW0	0.394	0.307	4.147E-10	418	0.184	0.141	Q8WWW0.pdb.gz	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
9	AFDB:Q9VN82	0.231	0.042	2.065E-4	2051	0.134	0.021	Q9VN82.pdb.gz	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
10	AFDB:A0A1D8PR83	0.214	0.044	2.472E-4	1690	0.103	0.020	A0A1D8PR83.pdb.gz	A0A1D8PR83_CANAL Adenylate cyclase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYR1 PE=3 SV=1
11	PDB:4rm8A	0.186	0.164	7.048E-3	368	0.031	0.027	4rm8A.pdb.gz
12	PDB:4f7zA	0.193	0.068	9.509E-3	946	0.037	0.013	4f7zA.pdb.gz
13	PDB:2byvE	0.171	0.064	1.208E-2	922	0.047	0.016	2byvE.pdb.gz
14	PDB:5swpA	0.161	0.056	1.951E-2	1060	0.040	0.012	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
15	PDB:7lq1A	0.161	0.062	2.200E-2	950	0.044	0.015	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5dxhD	0.167	0.063	2.795E-2	981	0.040	0.013	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
17	PDB:5itdA	0.173	0.063	4.004E-2	995	0.047	0.015	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
18	PDB:7rbsB	0.171	0.325	5.088E-2	157	0.044	0.089	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
19	PDB:4pyuA	0.167	0.613	7.738E-2	76	0.034	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
20	PDB:6pyuA	0.160	0.062	7.738E-2	930	0.040	0.014	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H2L5	0.0	665	321	1.000	1.000	RASF4_HUMAN Ras association domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RASSF4 PE=1 SV=2
2	P50749	9.05e-123	357	326	0.583	0.574	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
3	Q8BMS9	2.01e-119	348	326	0.567	0.558	RASF2_MOUSE Ras association domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rassf2 PE=1 SV=1
4	Q6ZTQ3	2.44e-62	204	369	0.383	0.333	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
5	Q80UQ2	1.24e-59	196	341	0.386	0.364	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
6	Q9VCQ7	1.06e-38	147	806	0.240	0.096	Q9VCQ7_DROME LD40758p OS=Drosophila melanogaster OX=7227 GN=Rassf PE=1 SV=3
7	Q5EBH1	4.76e-11	65.5	413	0.146	0.114	RASF5_MOUSE Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1
8	Q86WH2	4.82e-10	61.2	238	0.131	0.176	RASF3_HUMAN Ras association domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RASSF3 PE=1 SV=1
9	Q8WWW0	1.15e-09	61.2	418	0.140	0.108	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
10	Q9NS23	1.54e-09	60.5	344	0.165	0.154	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
11	Q5FAQ9	3.45e-09	59.7	340	0.153	0.144	Q5FAQ9_RAT Ras association domain family member 1 OS=Rattus norvegicus OX=10116 GN=Rassf1 PE=4 SV=1
12	Q99MK9	4.34e-09	59.3	340	0.150	0.141	RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rassf1 PE=1 SV=1
13	Q22744	1.74e-05	48.5	615	0.134	0.070	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
14	F8W9I4	0.015	38.9	247	0.078	0.101	F8W9I4_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
15	E9PFY5	0.017	38.5	250	0.078	0.100	E9PFY5_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
16	A8MQ02	0.037	38.5	1781	0.078	0.014	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
17	Q9BIC1	0.085	37.4	1658	0.087	0.017	Q9BIC1_CAEEL Afadin OS=Caenorhabditis elegans OX=6239 GN=afd-1 PE=1 SV=1
18	J3KN01	0.11	37.0	1816	0.081	0.014	J3KN01_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
19	O35889	0.11	37.0	1829	0.081	0.014	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
20	Q9QZQ1	0.11	37.0	1820	0.081	0.014	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20203 DUF6565	2.5e+02	13.6	Domain of unknown function (DUF6565)
2	PF16517 Nore1-SARAH	9.3e-10	49.5	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
3	PF00788 RA	6.2e-10	50.9	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339692

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429744	0.979	Serine/threonine-protein kinase 3
2	9606.ENSP00000361892	0.872	Serine/threonine-protein kinase 4
3	9606.ENSP00000368710	0.814	Ras association domain-containing protein 2
4	9606.ENSP00000380713	0.634	Ras association domain-containing protein 7
5	9606.ENSP00000307369	0.500	SH2 domain-containing adapter protein E
6	9606.ENSP00000381053	0.500	Zinc finger MYND domain-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.980	negative regulation of biological process
GO:0048523	0.951	negative regulation of cellular process
GO:0048522	0.940	positive regulation of cellular process
GO:0009966	0.908	regulation of signal transduction
GO:0050896	0.859	response to stimulus
GO:1902531	0.859	regulation of intracellular signal transduction
GO:0009987	0.858	cellular process
GO:0010941	0.843	regulation of cell death
GO:0019222	0.804	regulation of metabolic process
GO:0060255	0.753	regulation of macromolecule metabolic process
GO:0080090	0.732	regulation of primary metabolic process
GO:0051171	0.732	regulation of nitrogen compound metabolic process
GO:0031323	0.732	regulation of cellular metabolic process
GO:0032501	0.721	multicellular organismal process
GO:0051716	0.703	cellular response to stimulus
GO:0023052	0.680	signaling
GO:0042981	0.655	regulation of apoptotic process
GO:0007165	0.617	signal transduction
GO:0031647	0.516	regulation of protein stability
GO:0050821	0.514	protein stabilization
GO:0048771	0.509	tissue remodeling
GO:0050793	0.494	regulation of developmental process
GO:0009893	0.485	positive regulation of metabolic process
GO:0032502	0.481	developmental process
GO:0065009	0.457	regulation of molecular function
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0051173	0.447	positive regulation of nitrogen compound metabolic process
GO:0031325	0.446	positive regulation of cellular metabolic process
GO:0031399	0.437	regulation of protein modification process
GO:0042325	0.431	regulation of phosphorylation
GO:0051247	0.430	positive regulation of protein metabolic process
GO:0001932	0.416	regulation of protein phosphorylation
GO:0023057	0.402	negative regulation of signaling
GO:0010648	0.402	negative regulation of cell communication
GO:0048856	0.401	anatomical structure development
GO:0002682	0.378	regulation of immune system process
GO:0043065	0.349	positive regulation of apoptotic process
GO:0051239	0.347	regulation of multicellular organismal process
GO:0044093	0.329	positive regulation of molecular function
GO:0009892	0.329	negative regulation of metabolic process
GO:2000026	0.326	regulation of multicellular organismal development
GO:0050790	0.315	regulation of catalytic activity
GO:0001934	0.300	positive regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.946	cytosol
GO:0016020	0.927	membrane
GO:0043228	0.925	non-membrane-bounded organelle
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0071944	0.919	cell periphery
GO:0012505	0.899	endomembrane system
GO:0005886	0.877	plasma membrane
GO:0070013	0.827	intracellular organelle lumen
GO:0005654	0.816	nucleoplasm
GO:0032991	0.763	protein-containing complex
GO:0005794	0.639	Golgi apparatus
GO:0005694	0.627	chromosome
GO:0099080	0.590	supramolecular complex
GO:0098687	0.367	chromosomal region
GO:0000793	0.364	condensed chromosome
GO:0000775	0.355	chromosome, centromeric region
GO:0000776	0.351	kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]