StarFunc result for job id Q9H2M9

User Input

>input (1393 residues)
MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEP
EEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGW
SGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLL
NEDPVLQLKCRTYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAA
SGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTASNIGGFNAAIKNSPPA
MSQYITVGSNPFTGFFYALEGSTQPLLSHVALAVASKLTSALFNAASGWLGWKSKHEEEA
VQKQKPKVEPATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIR
MWKGYRDAQIGWIQTVEDLHERVPEKADFSPFGNSQGPSRVAQFLVIYAPRRGILEVWST
QQGPRVGAFNVGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH
LALSDKKSERAKDMHLVKKLAALLKTKSPNLDLVETEIKELILDIKYPATKKQALESILA
SERLPFSCLRNITQTLMDTLKSQELESVDEGLLQFCANKLKLLQLYESVSQLNSLDFHLD
TPFSDNDLALLLRLDEKELLKLQALLEKYKQENTRTNVRFSDDKDGVLPVKTFLEYLEYE
KDVLNIKKISEEEYVALGSFFFWKCLHGESSTEDMCHTLESAGLSPQLLLSLLLSVWLSK
EKDILDKPQSICCLHTMLSLLSKMKVAIDETWDSQSVSPWWQQMRTACIQSENNGAALLS
AHVGHSVAAQISNNMTEKKFSQTVLGADSEALTDSWEALSLDTEYWKLLLKQLEDCLILQ
TLLHSKGNTQTSKVSSLQAEPLPRLSVKKLLEGGKGGIADSVAKWIFKQDFSPEVLKLAN
EERDAENPDEPKEGVNRSFLEVSEMEMDLGAIPDLLHLAYEQFPCSLELDVLHAHCCWEY
VVQWNKDPEEARFFVRSIEHLKQIFNAHVQNGIALMMWNTFLVKRFSAATYLMDKVGKSP
KDRLCRRDVGMSDTAMTSFLGSCLDLLQILMEADVSRDEIQVPVLDTEDAWLSVEGPISI
VELALEQKHIHYPLVEHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLL
PSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPTEEATPTPFGKDQDWPALAVDLA
HHLQVSEDVVRRHYVGELYNYGVDHLGEEAILQVHDKEVLASQLLVLTGQRLAHALLHTQ
TKEGMELLARLPPTLCTWLKAMDPQDLQNTEVPIATTAKLVNKVIELLPEKHGQYGLALH
LIEAVEAISLPSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U1Z0	0.775	0.778	0.000	1386	0.889	0.893	Q5U1Z0.pdb.gz	RBGPR_RAT Rab3 GTPase-activating protein non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Rab3gap2 PE=1 SV=2
2	AFDB:Q9H2M9	1.000	1.000	0.000	1393	1.000	1.000	Q9H2M9.pdb.gz	RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1
3	AFDB:Q9VKB9	0.574	0.593	7.850E-65	1341	0.255	0.265	Q9VKB9.pdb.gz	RBGPR_DROME Rab3 GTPase-activating protein non-catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Rab3-GAP PE=1 SV=2
4	PDB:7qpgR	0.170	0.116	2.146E-11	2208	0.105	0.066	7qpgR.pdb.gz
5	AFDB:Q9HBG6	0.115	0.122	9.935E-9	1241	0.098	0.110	Q9HBG6.pdb.gz	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
6	AFDB:P90841	0.157	0.140	3.088E-8	1615	0.126	0.109	P90841.pdb.gz	P90841_CAEEL Neuroblastoma-amplified sequence OS=Caenorhabditis elegans OX=6239 GN=smgl-1 PE=1 SV=2
7	AFDB:Q9UTH0	0.162	0.187	4.138E-8	1162	0.110	0.132	Q9UTH0.pdb.gz	NU132_SCHPO Nucleoporin nup132 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup132 PE=1 SV=1
8	AFDB:Q9VRX2	0.122	0.135	4.292E-8	1229	0.098	0.111	Q9VRX2.pdb.gz	VPS8_DROME Vacuolar protein sorting-associated protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Vps8 PE=1 SV=1
9	AFDB:Q8T9D3	0.122	0.135	5.545E-8	1169	0.078	0.093	Q8T9D3.pdb.gz	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
10	AFDB:Q11182	0.177	0.267	5.966E-8	852	0.080	0.130	Q11182.pdb.gz	VPS16_CAEEL Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-16 PE=3 SV=2
11	AFDB:A2RRP1	0.144	0.092	1.602E-7	2371	0.126	0.074	A2RRP1.pdb.gz	NBAS_HUMAN NBAS subunit of NRZ tethering complex OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2
12	PDB:7r5jR0	0.125	0.124	7.513E-7	1399	0.106	0.106	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:1xi4A	0.118	0.106	9.706E-7	1630	0.106	0.090	1xi4A.pdb.gz
14	PDB:7ajtUA	0.094	0.142	1.349E-6	834	0.047	0.078	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mq8LR	0.123	0.200	1.562E-6	773	0.059	0.106	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7r5jD4	0.171	0.179	3.897E-6	1312	0.098	0.104	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7mqaLO	0.082	0.122	4.043E-6	819	0.044	0.074	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7r5jK0	0.140	0.174	4.193E-6	1086	0.099	0.127	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:6lqsB1	0.094	0.147	4.512E-6	806	0.046	0.079	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:7mq8LO	0.087	0.123	5.829E-6	848	0.050	0.081	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U1Z0	0.0	2499	1386	0.889	0.894	RBGPR_RAT Rab3 GTPase-activating protein non-catalytic subunit OS=Rattus norvegicus OX=10116 GN=Rab3gap2 PE=1 SV=2
2	Q9H2M9	0.0	2875	1393	1.000	1.000	RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1
3	Q9VKB9	1.05e-120	411	1341	0.264	0.274	RBGPR_DROME Rab3 GTPase-activating protein non-catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Rab3-GAP PE=1 SV=2
4	Q9VKK1	3.5	34.7	1354	0.017	0.018	EDC4_DROME Enhancer of mRNA-decapping protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Ge-1 PE=1 SV=2
5	Q8MQW7	4.7	34.3	1292	0.017	0.018	Q8MQW7_DROME SD06708p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
6	A0A0B4K7Q6	5.6	33.9	2008	0.017	0.011	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
7	Q961T2	5.7	33.9	720	0.024	0.046	Q961T2_DROME SD01170p OS=Drosophila melanogaster OX=7227 GN=Fbl6 PE=2 SV=1
8	Q9VCH4	5.8	33.9	1970	0.017	0.012	Q9VCH4_DROME Myoblast city OS=Drosophila melanogaster OX=7227 GN=mbc PE=1 SV=2
9	Q38A63	8.7	32.7	318	0.011	0.047	Q38A63_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1310 PE=1 SV=1
10	Q494G8	8.9	33.1	720	0.022	0.043	Q494G8_DROME F-box and leucine-rich repeat protein 6, isoform A OS=Drosophila melanogaster OX=7227 GN=Fbl6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14656 RAB3GAP2_C	6.6e-250	842.2	Rab3 GTPase-activating protein regulatory subunit C-terminus
2	PF14655 RAB3GAP2_N	5.6e-157	534.8	Rab3 GTPase-activating protein regulatory subunit N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411418	0.999	Rab3 GTPase-activating protein catalytic subunit
2	9606.ENSP00000254976	0.937	Synaptosomal-associated protein 25
3	9606.ENSP00000478479	0.933	Ras-related protein Rab-18
4	9606.ENSP00000355511	0.929	Rab proteins geranylgeranyltransferase component A 2
5	9606.ENSP00000350386	0.928	Rab proteins geranylgeranyltransferase component A 1
6	9606.ENSP00000311449	0.922	Ras-related protein Rab-6A
7	9606.ENSP00000428417	0.922	Regulating synaptic membrane exocytosis protein 1
8	9606.ENSP00000441858	0.921	DmX-like protein 2
9	9606.ENSP00000369538	0.919	Rab GDP dissociation inhibitor beta
10	9606.ENSP00000348965	0.917	Cytoplasmic dynein 1 heavy chain 1
11	9606.ENSP00000222812	0.915	Syntaxin-1A
12	9606.ENSP00000349351	0.912	Protein bicaudal D homolog 2
13	9606.ENSP00000367756	0.912	Protein unc-13 homolog B
14	9606.ENSP00000394071	0.912	Rab GDP dissociation inhibitor alpha
15	9606.ENSP00000285208	0.910	Ras-related protein Rab-6B
16	9606.ENSP00000314214	0.910	Vesicle-associated membrane protein 2
17	9606.ENSP00000281474	0.906	Protein bicaudal D homolog 1
18	9606.ENSP00000408910	0.903	Dynactin subunit 2
19	9606.ENSP00000414906	0.903	Dynactin subunit 4
20	9606.ENSP00000254286	0.902	Actin related protein 10 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.996	enzyme binding
GO:0005085	0.995	guanyl-nucleotide exchange factor activity
GO:0031267	0.992	small GTPase binding
GO:0005096	0.991	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.981	localization
GO:0065007	0.980	biological regulation
GO:0050794	0.963	regulation of cellular process
GO:0051641	0.962	cellular localization
GO:0051128	0.931	regulation of cellular component organization
GO:0048518	0.930	positive regulation of biological process
GO:0048522	0.898	positive regulation of cellular process
GO:0006810	0.865	transport
GO:0033043	0.851	regulation of organelle organization
GO:0033036	0.813	macromolecule localization
GO:0019222	0.806	regulation of metabolic process
GO:0008104	0.767	protein localization
GO:0044087	0.742	regulation of cellular component biogenesis
GO:0044088	0.737	regulation of vacuole organization
GO:0033365	0.718	protein localization to organelle
GO:0009894	0.710	regulation of catabolic process
GO:0031323	0.665	regulation of cellular metabolic process
GO:0070972	0.653	protein localization to endoplasmic reticulum
GO:0051649	0.651	establishment of localization in cell
GO:1902115	0.593	regulation of organelle assembly
GO:0009893	0.574	positive regulation of metabolic process
GO:0051668	0.569	localization within membrane
GO:0010506	0.516	regulation of autophagy
GO:0016241	0.512	regulation of macroautophagy
GO:0072657	0.443	protein localization to membrane
GO:0045184	0.441	establishment of protein localization
GO:0046907	0.412	intracellular transport
GO:0051130	0.411	positive regulation of cellular component organization
GO:0051246	0.386	regulation of protein metabolic process
GO:0010604	0.339	positive regulation of macromolecule metabolic process
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0071840	0.325	cellular component organization or biogenesis
GO:2000785	0.321	regulation of autophagosome assembly
GO:1902117	0.321	positive regulation of organelle assembly
GO:0031325	0.306	positive regulation of cellular metabolic process
GO:0071705	0.305	nitrogen compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0031090	0.999	organelle membrane
GO:0005783	0.998	endoplasmic reticulum
GO:0031984	0.997	organelle subcompartment
GO:0005789	0.993	endoplasmic reticulum membrane
GO:0005634	0.832	nucleus
GO:0070013	0.575	intracellular organelle lumen
GO:0031981	0.372	nuclear lumen
GO:0005654	0.353	nucleoplasm
GO:0031982	0.338	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]