StarFunc result for job id Q9H2S1

User Input

>input (579 residues)
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVS
SSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYK
LGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTII
LLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTAR
LAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRF
VMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIG
YGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK
NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLV
DLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFI
EAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58391	0.726	0.577	3.721E-56	732	0.724	0.572	P58391.pdb.gz	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
2	AFDB:Q92952	0.720	0.766	7.399E-52	543	0.644	0.687	Q92952.pdb.gz	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
3	AFDB:Q9EQR3	0.706	0.759	1.019E-49	537	0.611	0.659	Q9EQR3.pdb.gz	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
4	AFDB:V6CLK4	0.672	0.462	1.178E-33	855	0.401	0.271	V6CLK4.pdb.gz	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
5	AFDB:O15554	0.578	0.775	6.757E-28	427	0.314	0.426	O15554.pdb.gz	KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1
6	AFDB:O89109	0.623	0.840	7.084E-28	425	0.323	0.440	O89109.pdb.gz	KCNN4_MOUSE Intermediate conductance calcium-activated potassium channel protein 4 OS=Mus musculus OX=10090 GN=Kcnn4 PE=2 SV=1
7	PDB:6cnnA	0.556	0.876	2.369E-25	360	0.294	0.472	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
8	AFDB:D1MQ08	0.405	0.779	7.269E-16	295	0.207	0.407	D1MQ08.pdb.gz	D1MQ08_HUMAN Small conductance calcium activated potassium channel type 4 transcript variant 2 OS=Homo sapiens OX=9606 GN=KCNN4 PE=2 SV=1
9	PDB:7bylA	0.158	0.244	2.507E-6	354	0.097	0.158	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
10	AFDB:O88944	0.185	0.136	4.274E-6	873	0.133	0.088	O88944.pdb.gz	KCNQ3_RAT Potassium voltage-gated channel subfamily KQT member 3 OS=Rattus norvegicus OX=10116 GN=Kcnq3 PE=1 SV=2
11	PDB:7vnrA	0.155	0.254	1.832E-5	333	0.102	0.177	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
12	PDB:7w6sB	0.182	0.218	1.218E-4	448	0.114	0.147	7w6sB.pdb.gz
13	PDB:7f3fA	0.166	0.205	4.374E-4	460	0.102	0.128	7f3fA.pdb.gz
14	AFDB:F6NYL9	0.244	0.142	8.596E-4	1130	0.126	0.065	F6NYL9.pdb.gz
15	PDB:7phhA	0.132	0.188	1.498E-3	396	0.085	0.124	7phhA.pdb.gz
16	PDB:7sizB	0.144	0.245	8.243E-3	334	0.078	0.135	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
17	AFDB:B3DJX4	0.168	0.094	9.621E-3	1186	0.111	0.054	B3DJX4.pdb.gz
18	PDB:7calA	0.228	0.279	1.455E-2	444	0.079	0.104	7calA.pdb.gz
19	PDB:2a79B	0.143	0.307	1.600E-2	259	0.064	0.143	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
20	PDB:3lutB	0.137	0.200	1.933E-2	390	0.083	0.123	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58390	0.0	1167	839	0.981	0.677	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2
2	P58391	0.0	848	732	0.734	0.581	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
3	P70604	0.0	1174	580	0.988	0.986	KCNN2_RAT Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1
4	P70605	0.0	848	732	0.736	0.582	KCNN3_RAT Small conductance calcium-activated potassium channel protein 3 OS=Rattus norvegicus OX=10116 GN=Kcnn3 PE=2 SV=3
5	P70606	0.0	714	536	0.585	0.632	KCNN1_RAT Small conductance calcium-activated potassium channel protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnn1 PE=1 SV=2
6	Q7KVW5	0.0	622	927	0.499	0.312	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
7	Q92952	0.0	751	543	0.655	0.698	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
8	Q9EQR3	0.0	714	537	0.615	0.663	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
9	Q9H2S1	0.0	1203	579	1.000	1.000	KCNN2_HUMAN Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2
10	Q9UGI6	0.0	849	731	0.737	0.584	KCNN3_HUMAN Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2
11	V6CLK4	2.55e-135	416	855	0.363	0.246	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
12	O89109	9.84e-104	321	425	0.325	0.442	KCNN4_MOUSE Intermediate conductance calcium-activated potassium channel protein 4 OS=Mus musculus OX=10090 GN=Kcnn4 PE=2 SV=1
13	Q9QYW1	2.95e-101	315	425	0.318	0.433	KCNN4_RAT Intermediate conductance calcium-activated potassium channel protein 4 OS=Rattus norvegicus OX=10116 GN=Kcnn4 PE=2 SV=2
14	O15554	2.24e-100	313	427	0.316	0.429	KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1
15	D1MQ08	1.45e-66	220	295	0.207	0.407	D1MQ08_HUMAN Small conductance calcium activated potassium channel type 4 transcript variant 2 OS=Homo sapiens OX=9606 GN=KCNN4 PE=2 SV=1
16	A0A0B4KEP9	3.18e-07	55.8	827	0.107	0.075	A0A0B4KEP9_DROME KCNQ potassium channel, isoform J OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
17	B7YZR4	9.60e-07	54.3	683	0.057	0.048	B7YZR4_DROME KCNQ potassium channel, isoform C OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
18	A0A0B4KEI9	9.87e-07	54.3	823	0.057	0.040	A0A0B4KEI9_DROME KCNQ potassium channel, isoform H OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
19	A1Z856	1.02e-06	54.3	993	0.057	0.033	A1Z856_DROME KCNQ potassium channel, isoform F OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=2
20	Q5PXF9	1.10e-06	54.3	808	0.057	0.041	Q5PXF9_DROME KCNQ potassium channel, isoform E OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02888 CaMBD	1.2e-31	119.7	Calmodulin binding domain
2	PF20565 DUF6775	1.5e+02	13.3	Probable metallopeptidase family (DUF6775)
3	PF07885 Ion_trans_2	2.1e-09	48.5	Ion channel
4	PF07544 Med9	41	15.7	RNA polymerase II transcription mediator complex subunit 9
5	PF03530 SK_channel	1.1e-46	169.1	Calcium-activated SK potassium channel
6	PF12841 YvrJ	2.9e+02	12.4	YvrJ protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349467	0.972	Calmodulin-1
2	9606.ENSP00000286628	0.947	Calcium-activated potassium channel subunit alpha-1
3	9606.ENSP00000291295	0.936	Calmodulin 3 (phosphorylase kinase, delta)
4	9606.ENSP00000258111	0.925	Calcium-activated potassium channel subunit beta-4
5	9606.ENSP00000382770	0.911	Potassium channel subfamily U member 1
6	9606.ENSP00000333496	0.891	Potassium voltage-gated channel subfamily D member 2
7	9606.ENSP00000274629	0.885	Calcium-activated potassium channel subunit beta-1
8	9606.ENSP00000272298	0.867	Calmodulin 2 (phosphorylase kinase, delta)
9	9606.ENSP00000407592	0.855	Potassium large conductance calcium-activated channel, subfamily M, beta member 2
10	9606.ENSP00000319370	0.845	Calcium-activated potassium channel subunit beta-3
11	9606.ENSP00000262888	0.814	Intermediate conductance calcium-activated potassium channel protein 4
12	9606.ENSP00000476519	0.809	Small conductance calcium-activated potassium channel protein 1
13	9606.ENSP00000481848	0.808	Small conductance calcium-activated potassium channel protein 3
14	9606.ENSP00000256460	0.720	Calcium/calmodulin-dependent protein kinase type 1
15	9606.ENSP00000304822	0.710	Kappa-casein
16	9606.ENSP00000266376	0.699	Voltage-dependent L-type calcium channel subunit alpha-1C
17	9606.ENSP00000358784	0.649	Potassium voltage-gated channel subfamily A member 3
18	9606.ENSP00000263431	0.643	Protein kinase C gamma type
19	9606.ENSP00000305355	0.643	Protein kinase C beta type
20	9606.ENSP00000408695	0.639	Protein kinase C alpha type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015269	1.000	calcium-activated potassium channel activity
GO:0005515	0.999	protein binding
GO:0005249	0.991	voltage-gated potassium channel activity
GO:0016286	0.932	small conductance calcium-activated potassium channel activity
GO:0005516	0.522	calmodulin binding
GO:0099094	0.499	ligand-gated monoatomic cation channel activity
GO:0005242	0.425	inward rectifier potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030001	0.996	metal ion transport
GO:0051049	0.995	regulation of transport
GO:0006813	0.994	potassium ion transport
GO:0043266	0.987	regulation of potassium ion transport
GO:0009987	0.980	cellular process
GO:0050794	0.967	regulation of cellular process
GO:0098662	0.752	inorganic cation transmembrane transport
GO:0098655	0.750	monoatomic cation transmembrane transport
GO:0071805	0.735	potassium ion transmembrane transport
GO:0065008	0.607	regulation of biological quality
GO:0048518	0.345	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.938	protein-containing complex
GO:0098796	0.874	membrane protein complex
GO:1902495	0.839	transmembrane transporter complex
GO:0098797	0.836	plasma membrane protein complex
GO:0034703	0.785	cation channel complex
GO:0120025	0.487	plasma membrane bounded cell projection
GO:0043005	0.387	neuron projection
GO:0036477	0.378	somatodendritic compartment
GO:0043226	0.371	organelle
GO:0030054	0.371	cell junction
GO:0045202	0.353	synapse
GO:0005622	0.335	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]