StarFunc result for job id Q9H2S6

User Input

>input (317 residues)
MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKK
AYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKC
FIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDN
VTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASE
EELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVIC
RVIMPCNWWVARMLGRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EP64	0.479	0.479	1.816E-52	317	0.962	0.962	Q9EP64.pdb.gz	TNMD_MOUSE Tenomodulin OS=Mus musculus OX=10090 GN=Tnmd PE=2 SV=1
2	AFDB:O75829	0.447	0.428	1.397E-22	334	0.334	0.317	O75829.pdb.gz	CNMD_HUMAN Leukocyte cell-derived chemotaxin 1 OS=Homo sapiens OX=9606 GN=CNMD PE=1 SV=1
3	AFDB:O70367	0.426	0.408	1.101E-21	334	0.356	0.338	O70367.pdb.gz	CNMD_RAT Leukocyte cell-derived chemotaxin 1 OS=Rattus norvegicus OX=10116 GN=Cnmd PE=1 SV=1
4	AFDB:Q86XP6	0.340	0.555	1.363E-6	184	0.101	0.174	Q86XP6.pdb.gz	GKN2_HUMAN Gastrokine-2 OS=Homo sapiens OX=9606 GN=GKN2 PE=1 SV=2
5	AFDB:Q9CR36	0.257	0.390	4.290E-6	201	0.082	0.129	Q9CR36.pdb.gz	GKN1_MOUSE Gastrokine-1 OS=Mus musculus OX=10090 GN=Gkn1 PE=2 SV=3
6	AFDB:Q9NS71	0.281	0.430	7.188E-6	199	0.060	0.095	Q9NS71.pdb.gz	GKN1_HUMAN Gastrokine-1 OS=Homo sapiens OX=9606 GN=GKN1 PE=1 SV=4
7	AFDB:Q9CQS6	0.316	0.515	2.263E-5	184	0.095	0.163	Q9CQS6.pdb.gz	GKN2_MOUSE Gastrokine-2 OS=Mus musculus OX=10090 GN=Gkn2 PE=1 SV=1
8	AFDB:Q6PL45	0.263	0.315	8.962E-5	260	0.120	0.146	Q6PL45.pdb.gz	BRID5_HUMAN BRICHOS domain-containing protein 5 OS=Homo sapiens OX=9606 GN=BRICD5 PE=1 SV=3
9	AFDB:Q9D0T7	0.283	0.444	1.194E-4	191	0.063	0.105	Q9D0T7.pdb.gz	GKN3_MOUSE Gastrokine-3 OS=Mus musculus OX=10090 GN=Gkn3 PE=1 SV=1
10	PDB:6e8nA	0.168	0.274	2.836E-2	185	0.022	0.038	6e8nA.pdb.gz
11	AFDB:Q86B61	0.112	0.056	1.232E-1	670	0.044	0.021	Q86B61.pdb.gz	TBH1_DROME Tyramine beta-hydroxylase OS=Drosophila melanogaster OX=7227 GN=Tbh PE=1 SV=1
12	PDB:6mjpC	0.109	0.180	1.678E-1	174	0.044	0.080	6mjpC.pdb.gz	Structural basis of unidirectional export of lipopolysaccharide to the cell surface.
13	PDB:2w7qA	0.144	0.232	1.882E-1	192	0.016	0.026	2w7qA.pdb.gz
14	PDB:6jlaD	0.174	0.279	2.367E-1	188	0.028	0.048	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.
15	PDB:5hz9A	0.132	0.278	2.655E-1	135	0.025	0.059	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
16	PDB:7e25A	0.137	0.293	3.966E-1	139	0.028	0.065	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
17	PDB:2xn2A	0.102	0.049	4.989E-1	729	0.022	0.010	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
18	PDB:5lj5t	0.121	0.095	5.283E-1	438	0.047	0.034	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:7q3dA	0.128	0.080	5.925E-1	545	0.009	0.006	7q3dA.pdb.gz
20	PDB:7yf1A	0.131	0.281	7.038E-1	133	0.025	0.060	7yf1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EP64	0.0	638	317	0.962	0.962	TNMD_MOUSE Tenomodulin OS=Mus musculus OX=10090 GN=Tnmd PE=2 SV=1
2	Q9ESC2	0.0	602	317	0.946	0.946	TNMD_RAT Tenomodulin OS=Rattus norvegicus OX=10116 GN=Tnmd PE=1 SV=1
3	Q9H2S6	0.0	657	317	1.000	1.000	TNMD_HUMAN Tenomodulin OS=Homo sapiens OX=9606 GN=TNMD PE=1 SV=1
4	O70367	2.35e-62	202	334	0.363	0.344	CNMD_RAT Leukocyte cell-derived chemotaxin 1 OS=Rattus norvegicus OX=10116 GN=Cnmd PE=1 SV=1
5	Q9Z1F6	8.80e-62	201	334	0.363	0.344	CNMD_MOUSE Leukocyte cell-derived chemotaxin 1 OS=Mus musculus OX=10090 GN=Cnmd PE=1 SV=2
6	O75829	1.61e-59	195	334	0.356	0.338	CNMD_HUMAN Leukocyte cell-derived chemotaxin 1 OS=Homo sapiens OX=9606 GN=CNMD PE=1 SV=1
7	Q86XP6	0.014	38.1	184	0.101	0.174	GKN2_HUMAN Gastrokine-2 OS=Homo sapiens OX=9606 GN=GKN2 PE=1 SV=2
8	Q4WEY5	0.26	35.4	618	0.047	0.024	CCLA_ASPFU COMPASS component cclA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=cclA PE=3 SV=1
9	Q2U741	0.48	34.7	617	0.044	0.023	CCLA_ASPOR COMPASS component cclA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cclA PE=3 SV=1
10	Q9JLB2	0.65	34.3	675	0.082	0.039	PALS1_MOUSE Protein PALS1 OS=Mus musculus OX=10090 GN=Pals1 PE=1 SV=1
11	B4F7E7	0.79	33.9	675	0.082	0.039	PALS1_RAT Protein PALS1 OS=Rattus norvegicus OX=10116 GN=Pals1 PE=1 SV=1
12	Q9H4K1	0.87	33.5	382	0.079	0.065	RIBC2_HUMAN RIB43A-like with coiled-coils protein 2 OS=Homo sapiens OX=9606 GN=RIBC2 PE=1 SV=2
13	Q5AQN1	0.99	33.5	607	0.044	0.023	CCLA_EMENI COMPASS component cclA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cclA PE=3 SV=1
14	A0A3Q1LY00	1.1	33.5	675	0.079	0.037	A0A3Q1LY00_BOVIN Protein PALS1 OS=Bos taurus OX=9913 GN=PALS1 PE=1 SV=1
15	A0A2K9YVY7	1.2	31.2	82	0.044	0.171	A0A2K9YVY7_ZYMTR AvrStb6 OS=Zymoseptoria tritici OX=1047171 PE=4 SV=1
16	E2QY99	1.3	33.1	675	0.085	0.040	PALS1_CANLF Protein PALS1 OS=Canis lupus familiaris OX=9615 GN=PALS1 PE=1 SV=1
17	S6EZS3	2.2	32.7	1558	0.148	0.030	S6EZS3_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abt-1 PE=4 SV=1
18	Q8N3R9	2.3	32.3	675	0.082	0.039	PALS1_HUMAN Protein PALS1 OS=Homo sapiens OX=9606 GN=PALS1 PE=1 SV=3
19	Q9CQS6	2.6	31.6	184	0.088	0.152	GKN2_MOUSE Gastrokine-2 OS=Mus musculus OX=10090 GN=Gkn2 PE=1 SV=1
20	Q9FJ82	4.2	31.2	298	0.066	0.070	DAPB3_ARATH Dihydrodipicolinate reductase-like protein CRR1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DAPB3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04089 BRICHOS	4e-14	64.0	BRICHOS domain
2	PF05914 RIB43A	67	13.8	RIB43A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362122

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476384	0.860	Basic helix-loop-helix transcription factor scleraxis
2	9606.ENSP00000364946	0.842	Homeobox protein Mohawk
3	9606.ENSP00000272224	0.768	Growth/differentiation factor 7
4	9606.ENSP00000347041	0.752	Fibromodulin
5	9606.ENSP00000052754	0.747	Decorin
6	9606.ENSP00000339730	0.694	Thrombospondin-4
7	9606.ENSP00000297268	0.689	Collagen alpha-2(I) chain
8	9606.ENSP00000225964	0.685	Collagen alpha-1(I) chain
9	9606.ENSP00000384748	0.684	Transmembrane protein 79
10	9606.ENSP00000327336	0.662	Biglycan
11	9606.ENSP00000387356	0.636	Aggrecan core protein
12	9606.ENSP00000363492	0.629	Growth/differentiation factor 5
13	9606.ENSP00000222271	0.593	Cartilage oligomeric matrix protein
14	9606.ENSP00000304408	0.582	Collagen alpha-1(III) chain
15	9606.ENSP00000245479	0.581	Transcription factor SOX-9
16	9606.ENSP00000444211	0.578	Platelet-derived growth factor receptor-like protein
17	9606.ENSP00000287020	0.577	Growth/differentiation factor 6
18	9606.ENSP00000266719	0.550	Keratocan
19	9606.ENSP00000360493	0.539	Runt-related transcription factor 2
20	9606.ENSP00000442656	0.538	Activin receptor type-1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.997	anatomical structure development
GO:0009987	0.994	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050793	0.974	regulation of developmental process
GO:0009653	0.968	anatomical structure morphogenesis
GO:0048519	0.967	negative regulation of biological process
GO:0009888	0.955	tissue development
GO:0051239	0.951	regulation of multicellular organismal process
GO:0048869	0.940	cellular developmental process
GO:0030154	0.922	cell differentiation
GO:0050896	0.914	response to stimulus
GO:0048523	0.908	negative regulation of cellular process
GO:0051093	0.874	negative regulation of developmental process
GO:0042127	0.869	regulation of cell population proliferation
GO:0051241	0.869	negative regulation of multicellular organismal process
GO:0050678	0.839	regulation of epithelial cell proliferation
GO:2000026	0.830	regulation of multicellular organismal development
GO:1901342	0.816	regulation of vasculature development
GO:0045765	0.774	regulation of angiogenesis
GO:0016525	0.760	negative regulation of angiogenesis
GO:0001936	0.721	regulation of endothelial cell proliferation
GO:0032501	0.614	multicellular organismal process
GO:0070848	0.542	response to growth factor
GO:0048518	0.525	positive regulation of biological process
GO:0048468	0.518	cell development
GO:0048522	0.502	positive regulation of cellular process
GO:0008285	0.502	negative regulation of cell population proliferation
GO:0060429	0.480	epithelium development
GO:0007275	0.467	multicellular organism development
GO:0003158	0.427	endothelium development
GO:0030855	0.423	epithelial cell differentiation
GO:0071495	0.392	cellular response to endogenous stimulus
GO:0019222	0.359	regulation of metabolic process
GO:0071363	0.358	cellular response to growth factor stimulus
GO:0050680	0.348	negative regulation of epithelial cell proliferation
GO:0060255	0.341	regulation of macromolecule metabolic process
GO:0002064	0.317	epithelial cell development
GO:0001937	0.309	negative regulation of endothelial cell proliferation
GO:0003382	0.309	epithelial cell morphogenesis
GO:0001885	0.306	endothelial cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043227	0.999	membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0071944	0.996	cell periphery
GO:0016020	0.990	membrane
GO:0043229	0.985	intracellular organelle
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005576	0.979	extracellular region
GO:0005737	0.959	cytoplasm
GO:0005615	0.936	extracellular space
GO:0070013	0.895	intracellular organelle lumen
GO:0031982	0.817	vesicle
GO:0005794	0.811	Golgi apparatus
GO:0005886	0.724	plasma membrane
GO:1903561	0.370	extracellular vesicle
GO:0097708	0.325	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]