StarFunc result for job id Q9H2S9

User Input

>input (585 residues)
MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCE
SSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLL
EKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRS
HTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVS
SPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPD
SMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELV
AHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSRE
AGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQ
PPPTIVVGRHSPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFL
DHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C208	0.389	0.389	5.375E-84	586	0.969	0.968	Q8C208.pdb.gz	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
2	AFDB:Q9VQU9	0.145	0.115	5.169E-12	744	0.224	0.176	Q9VQU9.pdb.gz	BOWEL_DROME Protein bowel OS=Drosophila melanogaster OX=7227 GN=bowl PE=1 SV=1
3	AFDB:Q56UE1	0.141	0.129	3.728E-7	643	0.171	0.156	Q56UE1.pdb.gz	Q56UE1_EMEND NSDC OS=Emericella nidulans OX=162425 GN=nsdC PE=4 SV=1
4	AFDB:A0A5K4F1D0	0.128	0.035	4.815E-7	2566	0.176	0.040	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
5	AFDB:Q0GGX2	0.105	0.046	6.628E-7	1363	0.186	0.080	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
6	AFDB:Q61602	0.129	0.053	1.178E-6	1583	0.181	0.067	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
7	AFDB:G8BGH3	0.133	0.113	2.233E-6	724	0.168	0.135	G8BGH3.pdb.gz	G8BGH3_CANPC BCR1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=BCR1 PE=4 SV=1
8	AFDB:F1QSH8	0.127	0.052	3.073E-6	1553	0.188	0.071	F1QSH8.pdb.gz
9	AFDB:P10071	0.126	0.053	4.808E-6	1580	0.203	0.075	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
10	AFDB:Q9IA31	0.127	0.052	1.035E-5	1544	0.186	0.071	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
11	PDB:3w5kB	0.083	0.261	2.048E-4	110	0.065	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.037	0.047	1.074	434	0.031	0.041	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:6g90U	0.043	0.103	2.803	196	0.019	0.056	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:7z36B	0.055	0.066	2.803	446	0.036	0.047	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:5nrlU	0.045	0.104	3.185	196	0.019	0.056	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
16	PDB:5xbtA	0.055	0.090	4.113	271	0.024	0.052	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
17	PDB:6ff47	0.048	0.249	4.673	93	0.015	0.097	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:5iy7M	0.048	0.080	5.311	310	0.031	0.058	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
19	PDB:5z56v	0.055	0.150	5.311	167	0.027	0.096	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:7uhyC	0.038	0.038	6.858	578	0.022	0.022	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VPL6	0.0	1069	540	0.899	0.974	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1
2	P81183	0.0	549	526	0.503	0.559	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
3	Q8C208	0.0	1155	586	0.969	0.968	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
4	Q90W82	0.0	542	563	0.513	0.533	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
5	Q9H2S9	0.0	1191	585	1.000	1.000	IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=2
6	Q9UKS7	0.0	550	526	0.504	0.561	IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens OX=9606 GN=IKZF2 PE=1 SV=2
7	O42410	1.65e-169	493	518	0.460	0.519	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
8	Q13422	5.79e-168	489	519	0.460	0.518	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
9	Q03267	7.68e-161	471	517	0.453	0.513	IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=2
10	O93581	1.29e-142	425	537	0.434	0.473	O93581_DANRE DNA-binding protein Ikaros OS=Danio rerio OX=7955 GN=znfn1a1 PE=2 SV=1
11	Q5SWU0	7.95e-137	406	428	0.371	0.507	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
12	Q9UKT9	2.01e-136	408	509	0.374	0.430	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
13	O08900	9.26e-135	404	507	0.379	0.438	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
14	A0A087WU46	1.02e-97	303	336	0.289	0.503	A0A087WU46_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
15	A0A0A0MRA0	9.71e-66	216	249	0.198	0.466	A0A0A0MRA0_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
16	R9R4D9	1.85e-49	174	268	0.142	0.310	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
17	Q6DBW0	6.75e-27	115	419	0.183	0.255	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
18	Q8NDW4	4.19e-24	108	579	0.094	0.095	ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens OX=9606 GN=ZNF248 PE=1 SV=1
19	P17141	1.05e-22	104	594	0.113	0.111	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
20	Q96GC6	1.14e-22	104	653	0.089	0.080	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15961 DUF4764	6.6e+02	10.3	Domain of unknown function (DUF4764)
2	PF09237 GAGA	37	15.7	GAGA factor
3	PF00096 zf-C2H2	3.3e-13	60.4	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	5e-08	44.1	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	55	15.4	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	5.7e-16	69.3	Zinc-finger double domain
7	PF13909 zf-H2C2_5	0.28	22.3	C2H2-type zinc-finger domain
8	PF12874 zf-met	8.9e+02	11.7	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344544	0.885	Zinc finger protein Aiolos
2	9606.ENSP00000331614	0.826	DNA-binding protein Ikaros
3	9606.ENSP00000446830	0.799	DnaJ homolog subfamily C member 22
4	9606.ENSP00000357881	0.755	Zinc finger protein Pegasus
5	9606.ENSP00000338788	0.702	Zinc finger CCCH domain-containing protein 15
6	9606.ENSP00000267102	0.680	Protein LMBR1L
7	9606.ENSP00000385885	0.676	Dual specificity phosphatase 28
8	9606.ENSP00000365380	0.673	Forkhead box protein P3
9	9606.ENSP00000301067	0.605	Histone-lysine N-methyltransferase 2D
10	9606.ENSP00000272643	0.597	Thrombospondin type-1 domain-containing protein 7B
11	9606.ENSP00000337618	0.589	Magnesium transporter NIPA2
12	9606.ENSP00000416418	0.570	Sodium/hydrogen exchanger 8
13	9606.ENSP00000370343	0.567	Interferon regulatory factor 4
14	9606.ENSP00000328207	0.537	Tumor necrosis factor receptor superfamily member 18
15	9606.ENSP00000377001	0.536	Speckle-type POZ protein
16	9606.ENSP00000263666	0.531	E3 ubiquitin-protein ligase PDZRN3
17	9606.ENSP00000262189	0.516	Histone-lysine N-methyltransferase 2C
18	9606.ENSP00000325377	0.515	pre-mRNA 3' end processing protein WDR33
19	9606.ENSP00000348849	0.505	Ribosomal protein S26
20	9606.ENSP00000369293	0.505	Interleukin-2 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.998	DNA binding
GO:0043565	0.990	sequence-specific DNA binding
GO:0140297	0.935	DNA-binding transcription factor binding
GO:0043425	0.912	bHLH transcription factor binding
GO:0140110	0.876	transcription regulator activity
GO:1990837	0.727	sequence-specific double-stranded DNA binding
GO:0003700	0.637	DNA-binding transcription factor activity
GO:0019904	0.606	protein domain specific binding
GO:0043167	0.587	ion binding
GO:0000976	0.387	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0009987	0.980	cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0048519	0.942	negative regulation of biological process
GO:0010468	0.915	regulation of gene expression
GO:0048523	0.904	negative regulation of cellular process
GO:0019219	0.900	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.883	regulation of RNA metabolic process
GO:0010556	0.879	regulation of macromolecule biosynthetic process
GO:0031326	0.879	regulation of cellular biosynthetic process
GO:0006355	0.872	regulation of DNA-templated transcription
GO:0009892	0.859	negative regulation of metabolic process
GO:0010605	0.832	negative regulation of macromolecule metabolic process
GO:0045934	0.817	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.808	negative regulation of RNA metabolic process
GO:0048518	0.800	positive regulation of biological process
GO:0031327	0.795	negative regulation of cellular biosynthetic process
GO:0045892	0.747	negative regulation of DNA-templated transcription
GO:0048522	0.682	positive regulation of cellular process
GO:0009893	0.655	positive regulation of metabolic process
GO:0010604	0.638	positive regulation of macromolecule metabolic process
GO:0051173	0.593	positive regulation of nitrogen compound metabolic process
GO:0006357	0.573	regulation of transcription by RNA polymerase II
GO:0031325	0.486	positive regulation of cellular metabolic process
GO:0010557	0.391	positive regulation of macromolecule biosynthetic process
GO:0031328	0.383	positive regulation of cellular biosynthetic process
GO:0045893	0.345	positive regulation of DNA-templated transcription
GO:0071840	0.309	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0016604	0.894	nuclear body
GO:0005737	0.619	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]