StarFunc result for job id Q9H2W2

User Input

>input (232 residues)
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDP
GPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLA
ALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVD
VNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3T7	0.354	0.354	6.863E-31	232	1.000	1.000	A0A024R3T7.pdb.gz
2	AFDB:Q9WUI0	0.362	0.363	4.643E-22	231	0.694	0.697	Q9WUI0.pdb.gz	MIXL1_MOUSE Homeobox protein MIXL1 OS=Mus musculus OX=10090 GN=Mixl1 PE=1 SV=1
3	AFDB:P70368	0.303	0.367	5.855E-7	190	0.254	0.311	P70368.pdb.gz	SEBOX_MOUSE Homeobox protein SEBOX OS=Mus musculus OX=10090 GN=Sebox PE=2 SV=2
4	AFDB:A0A2R8QKN2	0.266	0.272	8.154E-7	227	0.259	0.264	A0A2R8QKN2.pdb.gz	A0A2R8QKN2_DANRE Homeobox protein prophet of Pit-1 OS=Danio rerio OX=7955 GN=si:ch211-93n23.5 PE=4 SV=1
5	AFDB:Q8JJ26	0.275	0.220	1.480E-6	293	0.250	0.198	Q8JJ26.pdb.gz	SEBOX_DANRE Homeobox protein SEBOX OS=Danio rerio OX=7955 GN=sebox PE=2 SV=2
6	AFDB:P09083	0.279	0.147	1.805E-6	449	0.211	0.109	P09083.pdb.gz	GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster OX=7227 GN=gsb-n PE=1 SV=2
7	AFDB:Q91V10	0.246	0.158	2.202E-6	363	0.297	0.190	Q91V10.pdb.gz	VSX1_MOUSE Visual system homeobox 1 OS=Mus musculus OX=10090 GN=Vsx1 PE=1 SV=1
8	AFDB:P22810	0.275	0.121	2.353E-6	542	0.259	0.111	P22810.pdb.gz	HMOC_DROME Homeotic protein ocelliless OS=Drosophila melanogaster OX=7227 GN=oc PE=2 SV=2
9	AFDB:A5WVY6	0.232	0.178	5.209E-6	307	0.224	0.169	A5WVY6.pdb.gz
10	AFDB:Q9NZR4	0.244	0.157	5.565E-6	365	0.284	0.181	Q9NZR4.pdb.gz	VSX1_HUMAN Visual system homeobox 1 OS=Homo sapiens OX=9606 GN=VSX1 PE=1 SV=2
11	PDB:4egcA	0.222	0.096	1.482E-2	539	0.060	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.217	0.597	3.070E-2	73	0.091	0.288	2hi3A.pdb.gz
13	PDB:7fbyA	0.157	0.222	1.097	153	0.052	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.187	0.335	1.745	113	0.043	0.088	5nr5A.pdb.gz
15	PDB:1yioA	0.137	0.158	2.274	198	0.039	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
16	PDB:7b93E	0.138	0.148	2.774	215	0.039	0.042	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:3wqyA	0.162	0.045	3.383	905	0.047	0.012	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
18	PDB:5mrca	0.147	0.186	3.383	177	0.043	0.056	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:7awtE	0.144	0.206	3.383	156	0.026	0.038	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:2cyyA	0.128	0.182	3.862	151	0.078	0.119	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H2W2	1.12e-166	460	232	1.000	1.000	MIXL1_HUMAN Homeobox protein MIXL1 OS=Homo sapiens OX=9606 GN=MIXL1 PE=1 SV=1
2	Q9WUI0	1.11e-101	296	231	0.694	0.697	MIXL1_MOUSE Homeobox protein MIXL1 OS=Mus musculus OX=10090 GN=Mixl1 PE=1 SV=1
3	Q5TYX1	2.67e-23	97.8	327	0.190	0.135	Q5TYX1_DANRE Homeobox protein MIXL1 OS=Danio rerio OX=7955 GN=bon PE=4 SV=1
4	P21711	3.74e-21	92.4	377	0.211	0.130	MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2
5	A0A2R8QKN2	5.24e-21	89.7	227	0.190	0.194	A0A2R8QKN2_DANRE Homeobox protein prophet of Pit-1 OS=Danio rerio OX=7955 GN=si:ch211-93n23.5 PE=4 SV=1
6	Q9U2Z0	5.98e-20	89.4	391	0.177	0.105	OTXH_CAEEL Homeobox protein ttx-1 OS=Caenorhabditis elegans OX=6239 GN=ttx-1 PE=1 SV=2
7	F1LMV3	2.46e-19	88.2	484	0.216	0.103	F1LMV3_RAT Paired box 3 OS=Rattus norvegicus OX=10116 GN=Pax3 PE=3 SV=2
8	P23760	2.84e-19	87.8	479	0.216	0.104	PAX3_HUMAN Paired box protein Pax-3 OS=Homo sapiens OX=9606 GN=PAX3 PE=1 SV=2
9	P24610	2.95e-19	87.8	479	0.216	0.104	PAX3_MOUSE Paired box protein Pax-3 OS=Mus musculus OX=10090 GN=Pax3 PE=1 SV=2
10	Q91994	2.95e-19	86.7	323	0.185	0.133	OTX1B_DANRE Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1
11	P32242	5.46e-19	86.3	354	0.177	0.116	OTX1_HUMAN Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=OTX1 PE=1 SV=1
12	P09083	6.15e-19	87.0	449	0.172	0.089	GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster OX=7227 GN=gsb-n PE=1 SV=2
13	Q0IH87	6.63e-19	87.0	483	0.211	0.101	PAX3B_XENLA Paired box protein Pax-3-B OS=Xenopus laevis OX=8355 GN=pax3-b PE=2 SV=2
14	P80205	7.65e-19	85.9	355	0.177	0.115	OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1
15	Q645N4	8.21e-19	86.7	484	0.211	0.101	PAX3A_XENLA Paired box protein Pax-3-A OS=Xenopus laevis OX=8355 GN=pax3-a PE=2 SV=1
16	Q1LVQ7	9.46e-19	85.1	320	0.164	0.119	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
17	Q8QGS3	1.12e-18	86.3	484	0.216	0.103	Q8QGS3_CHICK Paired box 3 OS=Gallus gallus OX=9031 GN=Pax3 PE=2 SV=1
18	O57418	1.42e-18	85.9	507	0.185	0.085	O57418_DANRE Paired box 7 isoform PAX7C OS=Danio rerio OX=7955 GN=pax7 PE=2 SV=1
19	A0A0R4IM38	1.57e-18	85.9	487	0.185	0.088	A0A0R4IM38_DANRE Paired box 7 isoform PAX7D OS=Danio rerio OX=7955 GN=pax7a PE=3 SV=1
20	Q91813	1.62e-18	84.0	288	0.172	0.139	OTX2A_XENLA Homeobox protein OTX2-A OS=Xenopus laevis OX=8355 GN=otx2-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	26	16.1	Homeobox KN domain
2	PF00046 Homeodomain	2.8e-16	70.4	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000002089

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000007525	0.713	T, brachyury homolog (mouse)
2	9593.ENSGGOP00000023161	0.676	SRY-box 17
3	9593.ENSGGOP00000008166	0.640	Eomesodermin
4	9593.ENSGGOP00000020817	0.593	Forkhead box A2
5	9593.ENSGGOP00000015870	0.565	Forkhead box H1
6	9593.ENSGGOP00000012606	0.556	T-box transcription factor TBX6
7	9593.ENSGGOP00000012682	0.554	CCR4-NOT transcription complex, subunit 3
8	9593.ENSGGOP00000004075	0.547	Belongs to the syndecan proteoglycan family.
9	9593.ENSGGOP00000000119	0.544	GATA binding protein 5
10	9593.ENSGGOP00000010510	0.542	GATA binding protein 4
11	9593.ENSGGOP00000022447	0.524	POU domain protein
12	9593.ENSGGOP00000022867	0.514	SRY-box 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0008134	0.998	transcription factor binding
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0000981	0.993	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.981	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140297	0.914	DNA-binding transcription factor binding
GO:0061629	0.858	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228	0.672	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.573	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.436	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.989	anatomical structure development
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0007275	0.978	multicellular organism development
GO:0006357	0.970	regulation of transcription by RNA polymerase II
GO:0048518	0.969	positive regulation of biological process
GO:0009893	0.958	positive regulation of metabolic process
GO:0009987	0.933	cellular process
GO:0045893	0.903	positive regulation of DNA-templated transcription
GO:0048731	0.837	system development
GO:0045944	0.725	positive regulation of transcription by RNA polymerase II
GO:0048513	0.712	animal organ development
GO:0009653	0.627	anatomical structure morphogenesis
GO:0050896	0.413	response to stimulus
GO:0009888	0.362	tissue development
GO:0048519	0.358	negative regulation of biological process
GO:0048869	0.342	cellular developmental process
GO:0048523	0.314	negative regulation of cellular process
GO:0030154	0.308	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]