StarFunc result for job id Q9H2X0

User Input

>input (955 residues)
MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGH
CCQTCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSISYRRLDRPTRIRFSDSNGSVLFEHPAAPTQDGLVCGVWRA
VPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGI
TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA
EVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ
TGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHT
AVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAG
ALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLK
GFYGSEAQGVVKDLEPELLRHLAKGMASLMITTKGSPRGELRGQVHIANQCEVGGLRLEA
AGAEGVRALGAPDTASAAPPVVPGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAP
NYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDP
GEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR
VNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITC
RCGAGVPHCERDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2X0	1.000	1.000	0.000	955	1.000	1.000	Q9H2X0.pdb.gz	CHRD_HUMAN Chordin OS=Homo sapiens OX=9606 GN=CHRD PE=1 SV=2
2	AFDB:Q9Z0E2	0.731	0.735	0.000	948	0.864	0.870	Q9Z0E2.pdb.gz	CHRD_MOUSE Chordin OS=Mus musculus OX=10090 GN=Chrd PE=1 SV=1
3	AFDB:O57472	0.516	0.524	8.784E-92	940	0.462	0.469	O57472.pdb.gz	CHRD_DANRE Chordin OS=Danio rerio OX=7955 GN=chd PE=2 SV=1
4	PDB:4ziqA	0.102	0.078	5.716E-5	1450	0.066	0.043	4ziqA.pdb.gz
5	AFDB:P32927	0.079	0.083	6.041E-5	897	0.120	0.128	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
6	AFDB:G3V608	0.069	0.071	1.645E-4	895	0.115	0.123	G3V608.pdb.gz	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
7	AFDB:P97798	0.081	0.061	1.725E-4	1493	0.117	0.075	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
8	AFDB:Q967D7	0.074	0.054	2.296E-4	1531	0.121	0.076	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
9	AFDB:Q4ZHG4	0.093	0.055	4.268E-4	1894	0.134	0.068	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
10	AFDB:Q57WH0	0.072	0.061	6.251E-4	1241	0.112	0.086	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
11	PDB:4rtdA	0.090	0.079	1.395E-3	1122	0.063	0.053	4rtdA.pdb.gz
12	AFDB:P14738	0.057	0.055	1.475E-3	1018	0.104	0.097	P14738.pdb.gz	FNBA_STAA8 Fibronectin-binding protein A OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fnbA PE=1 SV=1
13	PDB:7q1yA	0.085	0.067	2.594E-3	1374	0.057	0.039	7q1yA.pdb.gz
14	PDB:7vonA	0.101	0.076	3.292E-3	1399	0.053	0.036	7vonA.pdb.gz
15	PDB:6h03A	0.100	0.082	6.732E-3	1223	0.068	0.053	6h03A.pdb.gz
16	PDB:4o9yA	0.072	0.041	7.061E-3	2490	0.050	0.019	4o9yA.pdb.gz
17	PDB:6sueA	0.086	0.047	8.962E-3	2292	0.041	0.017	6sueA.pdb.gz
18	PDB:6dtkE	0.100	0.245	1.193E-2	313	0.032	0.099	6dtkE.pdb.gz	Structural characterization of heterodimers of FALS mutant SOD enzyme
19	PDB:7q5zA	0.114	0.087	1.312E-2	1344	0.059	0.042	7q5zA.pdb.gz
20	PDB:7q3eA	0.068	0.098	2.684E-2	551	0.041	0.071	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O57472	0.0	857	940	0.468	0.476	CHRD_DANRE Chordin OS=Danio rerio OX=7955 GN=chd PE=2 SV=1
2	Q91713	0.0	942	941	0.509	0.516	CHRD_XENLA Chordin OS=Xenopus laevis OX=8355 GN=chrd PE=1 SV=1
3	Q9H2X0	0.0	1905	955	1.000	1.000	CHRD_HUMAN Chordin OS=Homo sapiens OX=9606 GN=CHRD PE=1 SV=2
4	Q9Z0E2	0.0	1552	948	0.861	0.867	CHRD_MOUSE Chordin OS=Mus musculus OX=10090 GN=Chrd PE=1 SV=1
5	Q24025	8.81e-91	313	1038	0.268	0.247	SOG_DROME Dorsal-ventral patterning protein Sog OS=Drosophila melanogaster OX=7227 GN=sog PE=1 SV=1
6	Q6WN34	6.27e-14	77.4	429	0.084	0.186	CRDL2_HUMAN Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1
7	Q76LD0	1.31e-11	70.1	447	0.073	0.157	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
8	F1Q633	3.29e-11	70.5	3970	0.070	0.017	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
9	A0A0R4IQJ3	3.80e-11	70.1	4003	0.071	0.017	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
10	Q8VEA6	2.44e-10	66.2	426	0.074	0.167	CRDL2_MOUSE Chordin-like protein 2 OS=Mus musculus OX=10090 GN=Chrdl2 PE=1 SV=1
11	Q80T14	2.88e-10	67.4	4010	0.072	0.017	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
12	B4XEZ3	6.26e-10	65.1	454	0.044	0.093	B4XEZ3_DANRE Chordin-like 2 OS=Danio rerio OX=7955 GN=CHL PE=2 SV=1
13	Q9BU40	6.12e-09	62.0	456	0.048	0.101	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
14	Q920C1	1.77e-08	60.5	447	0.047	0.101	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1
15	Q9GYX3	6.08e-08	59.3	751	0.065	0.083	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
16	Q9W2H2	6.24e-08	58.9	751	0.065	0.083	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
17	Q3U492	1.17e-07	58.5	1550	0.064	0.039	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
18	Q7T3Q2	1.57e-07	58.2	1027	0.070	0.065	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
19	Q6U1J5	1.40e-06	55.1	1447	0.029	0.019	Q6U1J5_DANRE Chihuahua OS=Danio rerio OX=7955 GN=chi PE=1 SV=1
20	Q96DN2	3.95e-06	53.5	955	0.063	0.063	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07452 CHRD	2.7e-39	146.1	CHRD domain
2	PF00093 VWC	1.9e-29	113.1	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000204604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245451	0.999	Bone morphogenetic protein 4
2	9606.ENSP00000368104	0.998	Bone morphogenetic protein 2
3	9606.ENSP00000262120	0.992	Twisted gastrulation protein homolog 1
4	9606.ENSP00000305714	0.981	Bone morphogenetic protein 1
5	9606.ENSP00000361107	0.975	Bone morphogenetic protein receptor type-1A
6	9606.ENSP00000401907	0.967	Bone morphogenetic protein receptor type-1B
7	9606.ENSP00000364683	0.961	BMP and activin membrane-bound inhibitor homolog
8	9606.ENSP00000363708	0.960	Bone morphogenetic protein receptor type-2
9	9606.ENSP00000061240	0.958	Tolloid-like protein 1
10	9606.ENSP00000379204	0.948	Bone morphogenetic protein 7
11	9606.ENSP00000350630	0.946	Tolloid-like protein 2
12	9606.ENSP00000327758	0.932	Homeobox protein Nkx-2.5
13	9606.ENSP00000334458	0.925	Transcription factor GATA-4
14	9606.ENSP00000308219	0.922	RGM domain family member B
15	9606.ENSP00000452126	0.917	Repulsive guidance molecule A
16	9606.ENSP00000359866	0.916	Bone morphogenetic protein 5
17	9606.ENSP00000337014	0.913	Hemojuvelin
18	9606.ENSP00000283147	0.912	Bone morphogenetic protein 6
19	9606.ENSP00000256759	0.907	Follistatin
20	9606.ENSP00000264110	0.902	Cyclic AMP-dependent transcription factor ATF-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007275	0.993	multicellular organism development
GO:0050896	0.986	response to stimulus
GO:0048519	0.972	negative regulation of biological process
GO:0023052	0.969	signaling
GO:0007154	0.969	cell communication
GO:0070848	0.967	response to growth factor
GO:0048731	0.967	system development
GO:0048513	0.964	animal organ development
GO:0048523	0.954	negative regulation of cellular process
GO:0071363	0.951	cellular response to growth factor stimulus
GO:0045667	0.948	regulation of osteoblast differentiation
GO:0009653	0.947	anatomical structure morphogenesis
GO:0090288	0.946	negative regulation of cellular response to growth factor stimulus
GO:0007167	0.945	enzyme-linked receptor protein signaling pathway
GO:0007178	0.944	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071773	0.942	cellular response to BMP stimulus
GO:0048522	0.941	positive regulation of cellular process
GO:0030514	0.937	negative regulation of BMP signaling pathway
GO:0009953	0.929	dorsal/ventral pattern formation
GO:0030509	0.913	BMP signaling pathway
GO:0009888	0.907	tissue development
GO:0009790	0.903	embryo development
GO:0045596	0.894	negative regulation of cell differentiation
GO:0001501	0.878	skeletal system development
GO:0007399	0.848	nervous system development
GO:0035295	0.819	tube development
GO:0043009	0.799	chordate embryonic development
GO:0007417	0.799	central nervous system development
GO:0045668	0.785	negative regulation of osteoblast differentiation
GO:0060429	0.756	epithelium development
GO:0042127	0.752	regulation of cell population proliferation
GO:0019222	0.612	regulation of metabolic process
GO:0048869	0.600	cellular developmental process
GO:0030154	0.560	cell differentiation
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0080090	0.528	regulation of primary metabolic process
GO:0051171	0.478	regulation of nitrogen compound metabolic process
GO:0040012	0.452	regulation of locomotion
GO:0031323	0.413	regulation of cellular metabolic process
GO:0008284	0.388	positive regulation of cell population proliferation
GO:0051239	0.386	regulation of multicellular organismal process
GO:0023056	0.331	positive regulation of signaling
GO:0010647	0.326	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0009986	0.939	cell surface
GO:0043226	0.755	organelle
GO:0043227	0.749	membrane-bounded organelle
GO:0005622	0.669	intracellular anatomical structure
GO:0043231	0.643	intracellular membrane-bounded organelle
GO:0070013	0.335	intracellular organelle lumen
GO:0005737	0.333	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]