StarFunc result for job id Q9H2X6

User Input

>input (1198 residues)
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLS
QPATTTVSTSLPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTV
SLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG
QIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY
IRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVN
MTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTH
VKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTS
ATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQALIVCPP
GFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPSGTQQILLPPAW
QQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPALLTGHVTLPAA
QPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQ
KHAPTSTVSKQRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHC
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGA
ITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPTMAQAPYSFPHNSPSH
GTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHLVASQGSARHTVQHTAYPASI
VHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPAKVNQYPYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H2X6	0.999	0.999	0.000	1198	1.000	1.000	Q9H2X6.pdb.gz	HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
2	AFDB:Q5SQL3	0.364	0.373	8.480E-103	1165	0.656	0.675	Q5SQL3.pdb.gz	Q5SQL3_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
3	AFDB:O88904	0.391	0.387	1.672E-102	1210	0.655	0.649	O88904.pdb.gz	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
4	AFDB:J3KP92	0.348	0.354	6.401E-98	1176	0.632	0.644	J3KP92.pdb.gz	J3KP92_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
5	AFDB:Q9H422	0.346	0.342	1.659E-87	1215	0.525	0.518	Q9H422.pdb.gz	HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens OX=9606 GN=HIPK3 PE=1 SV=1
6	AFDB:F6NWN5	0.341	0.332	1.058E-79	1229	0.472	0.461	F6NWN5.pdb.gz	F6NWN5_DANRE Homeodomain-interacting protein kinase 3a OS=Danio rerio OX=7955 GN=si:dkey-21k24.2 PE=4 SV=1
7	AFDB:M9PDR2	0.322	0.307	2.697E-65	1256	0.392	0.374	M9PDR2.pdb.gz	M9PDR2_DROME Homeodomain interacting protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
8	PDB:6khdB	0.243	0.838	4.352E-26	332	0.087	0.313	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
9	PDB:5y86A	0.243	0.711	4.335E-25	395	0.093	0.284	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
10	PDB:6qx9K	0.243	0.869	1.054E-24	322	0.088	0.329	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
11	PDB:6kheA	0.244	0.818	1.110E-24	342	0.082	0.287	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
12	PDB:6fadC	0.235	0.731	7.608E-22	359	0.078	0.262	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
13	PDB:4krcA	0.213	0.811	2.655E-20	297	0.068	0.276	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	AFDB:Q9TW45	0.202	0.203	3.998E-20	1192	0.179	0.180	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
15	AFDB:Q9W532	0.210	0.182	1.555E-19	1398	0.161	0.138	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
16	PDB:1unlA	0.209	0.809	1.652E-19	292	0.073	0.301	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:1j1bB	0.207	0.655	1.734E-18	364	0.075	0.247	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
18	PDB:3mi9A	0.211	0.702	1.734E-18	329	0.073	0.264	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
19	AFDB:P38990	0.206	0.216	2.233E-18	1142	0.152	0.159	P38990.pdb.gz	SAK1_YEAST SNF1-activating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAK1 PE=1 SV=1
20	PDB:7opmA	0.214	0.671	6.744E-18	362	0.073	0.240	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6M3Q6U2	0.0	708	1409	0.291	0.248	A0A6M3Q6U2_DROME Homeodomain interacting protein kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
2	F1Q4N0	0.0	1885	1228	0.806	0.786	F1Q4N0_DANRE Homeodomain-interacting protein kinase 2 OS=Danio rerio OX=7955 GN=cb1009 PE=4 SV=1
3	F6NWN5	0.0	967	1229	0.499	0.487	F6NWN5_DANRE Homeodomain-interacting protein kinase 3a OS=Danio rerio OX=7955 GN=si:dkey-21k24.2 PE=4 SV=1
4	H7BXX9	0.0	1671	911	0.670	0.881	H7BXX9_HUMAN Homeodomain interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
5	J3KP92	0.0	1348	1176	0.630	0.642	J3KP92_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
6	M9PDR2	0.0	708	1256	0.293	0.279	M9PDR2_DROME Homeodomain interacting protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
7	O88904	0.0	1412	1210	0.656	0.650	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
8	Q5SQL3	0.0	1433	1165	0.652	0.670	Q5SQL3_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
9	Q86Z02	0.0	1412	1210	0.652	0.645	HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
10	Q9ERH7	0.0	1090	1192	0.538	0.540	HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus OX=10090 GN=Hipk3 PE=1 SV=3
11	Q9H2X6	0.0	2479	1198	1.000	1.000	HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
12	Q9H422	0.0	1101	1215	0.538	0.531	HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens OX=9606 GN=HIPK3 PE=1 SV=1
13	Q9QZR5	0.0	2404	1196	0.967	0.969	HIPK2_MOUSE Homeodomain-interacting protein kinase 2 OS=Mus musculus OX=10090 GN=Hipk2 PE=1 SV=2
14	Q9W0Q1	0.0	709	1340	0.291	0.260	Q9W0Q1_DROME Homeodomain interacting protein kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=2
15	Q8MQ70	1.85e-179	551	846	0.230	0.325	HIPK_CAEEL Homeodomain-interacting protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=hpk-1 PE=2 SV=1
16	Q95TG3	7.86e-162	512	1068	0.217	0.243	Q95TG3_DROME SD08329p OS=Drosophila melanogaster OX=7227 GN=Hipk PE=2 SV=1
17	Q8NE63	1.66e-107	353	616	0.149	0.289	HIPK4_HUMAN Homeodomain-interacting protein kinase 4 OS=Homo sapiens OX=9606 GN=HIPK4 PE=1 SV=1
18	Q3V016	1.38e-106	350	616	0.147	0.286	HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus OX=10090 GN=Hipk4 PE=1 SV=2
19	P14680	7.58e-77	273	807	0.126	0.187	YAK1_YEAST Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAK1 PE=1 SV=1
20	Q9P6P3	1.78e-75	262	534	0.123	0.275	PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	28	16.0	Phosphotransferase enzyme family
2	PF06293 Kdo	0.0024	28.8	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	1e-47	174.3	Protein kinase domain
4	PF17667 Pkinase_fungal	12	16.2	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	8.6e-21	85.9	Protein tyrosine and serine/threonine kinase
6	PF05445 Pox_ser-thr_kin	74	13.8	Poxvirus serine/threonine protein kinase
7	PF19974 TCAD9	49	14.4	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000348056	0.992	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000349156	0.989	E3 ubiquitin-protein ligase SIAH1
4	9606.ENSP00000262320	0.979	Axin-1
5	9606.ENSP00000376077	0.979	Small ubiquitin-related modifier 1
6	9606.ENSP00000263253	0.971	Histone acetyltransferase p300
7	9606.ENSP00000395535	0.965	Methyl-CpG-binding protein 2
8	9606.ENSP00000363668	0.964	Death domain-associated protein 6
9	9606.ENSP00000358335	0.952	Mitogen-activated protein kinase kinase kinase 7
10	9606.ENSP00000384625	0.945	Serine/threonine-protein kinase NLK
11	9606.ENSP00000300305	0.935	Runt-related transcription factor 1
12	9606.ENSP00000462099	0.935	Ras association domain-containing protein 5
13	9606.ENSP00000483236	0.933	DDB1- and CUL4-associated factor 7
14	9606.ENSP00000268058	0.922	Protein PML
15	9606.ENSP00000356426	0.922	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
16	9606.ENSP00000216160	0.917	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
17	9606.ENSP00000415151	0.908	Core-binding factor subunit beta
18	9606.ENSP00000344215	0.904	Tumor protein p53-inducible nuclear protein 1
19	9606.ENSP00000365663	0.900	Natriuretic peptides A
20	9606.ENSP00000247970	0.884	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0140110	0.960	transcription regulator activity
GO:0003712	0.836	transcription coregulator activity
GO:0003714	0.781	transcription corepressor activity
GO:0046332	0.631	SMAD binding
GO:0046790	0.520	virion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0071704	0.965	organic substance metabolic process
GO:0050896	0.951	response to stimulus
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0051171	0.931	regulation of nitrogen compound metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0080090	0.918	regulation of primary metabolic process
GO:0044238	0.912	primary metabolic process
GO:0043170	0.877	macromolecule metabolic process
GO:0048522	0.877	positive regulation of cellular process
GO:0010468	0.873	regulation of gene expression
GO:0048523	0.872	negative regulation of cellular process
GO:0044237	0.852	cellular metabolic process
GO:0006915	0.845	apoptotic process
GO:0007154	0.843	cell communication
GO:0006807	0.823	nitrogen compound metabolic process
GO:0019219	0.819	regulation of nucleobase-containing compound metabolic process
GO:0023052	0.807	signaling
GO:0097190	0.797	apoptotic signaling pathway
GO:0051252	0.790	regulation of RNA metabolic process
GO:0031326	0.786	regulation of cellular biosynthetic process
GO:0009893	0.783	positive regulation of metabolic process
GO:0010556	0.783	regulation of macromolecule biosynthetic process
GO:2001141	0.770	regulation of RNA biosynthetic process
GO:0031325	0.719	positive regulation of cellular metabolic process
GO:0035556	0.714	intracellular signal transduction
GO:0010604	0.712	positive regulation of macromolecule metabolic process
GO:0043412	0.711	macromolecule modification
GO:0006355	0.708	regulation of DNA-templated transcription
GO:0051173	0.693	positive regulation of nitrogen compound metabolic process
GO:1901564	0.692	organonitrogen compound metabolic process
GO:0006950	0.660	response to stress
GO:0019538	0.651	protein metabolic process
GO:0036211	0.622	protein modification process
GO:0072331	0.558	signal transduction by p53 class mediator
GO:0071840	0.557	cellular component organization or biogenesis
GO:0009892	0.557	negative regulation of metabolic process
GO:0048583	0.539	regulation of response to stimulus
GO:0032502	0.523	developmental process
GO:0023051	0.510	regulation of signaling
GO:0010646	0.510	regulation of cell communication
GO:0033554	0.510	cellular response to stress
GO:0048856	0.505	anatomical structure development
GO:0009966	0.487	regulation of signal transduction
GO:0016043	0.482	cellular component organization
GO:0051246	0.482	regulation of protein metabolic process
GO:0006468	0.451	protein phosphorylation
GO:0031324	0.445	negative regulation of cellular metabolic process
GO:0010605	0.444	negative regulation of macromolecule metabolic process
GO:0051172	0.434	negative regulation of nitrogen compound metabolic process
GO:0006974	0.421	cellular response to DNA damage stimulus
GO:0007166	0.421	cell surface receptor signaling pathway
GO:0045935	0.421	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.404	positive regulation of RNA metabolic process
GO:0009891	0.403	positive regulation of biosynthetic process
GO:0097193	0.388	intrinsic apoptotic signaling pathway
GO:0065009	0.365	regulation of molecular function
GO:0009894	0.362	regulation of catabolic process
GO:0050793	0.352	regulation of developmental process
GO:1902531	0.334	regulation of intracellular signal transduction
GO:0032501	0.313	multicellular organismal process
GO:0042221	0.306	response to chemical
GO:0010557	0.304	positive regulation of macromolecule biosynthetic process
GO:0031328	0.304	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.962	cytosol
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0032991	0.901	protein-containing complex
GO:0016604	0.871	nuclear body
GO:0016605	0.730	PML body
GO:0005815	0.325	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]