StarFunc result for job id Q9H2X9

User Input

>input (1139 residues)
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFLNATCDEYFTR
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
ETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6m1yA	0.796	0.963	0.000	938	0.631	0.767	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
2	PDB:6m23A	0.789	0.954	0.000	936	0.822	1.000	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
3	PDB:7d99A	0.748	0.949	0.000	891	0.619	0.791	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
4	AFDB:A0A0B4LGD3	0.817	0.862	0.000	1077	0.498	0.526	A0A0B4LGD3.pdb.gz	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
5	AFDB:A0A2R8RX62	0.904	0.899	0.000	1146	0.731	0.727	A0A2R8RX62.pdb.gz
6	AFDB:Q28677	0.870	0.913	0.000	1085	0.670	0.703	Q28677.pdb.gz	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
7	AFDB:Q5RK27	0.902	0.948	0.000	1083	0.698	0.734	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
8	AFDB:Q63633	0.964	0.964	0.000	1139	0.982	0.982	Q63633.pdb.gz	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
9	AFDB:Q924N4	0.872	0.863	0.000	1150	0.676	0.670	Q924N4.pdb.gz	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
10	PDB:6y5rA	0.728	0.933	2.428E-102	879	0.600	0.777	6y5rA.pdb.gz
11	PDB:7airA	0.709	0.902	2.476E-96	885	0.597	0.768	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
12	PDB:7d14A	0.685	0.904	1.016E-89	850	0.723	0.968	7d14A.pdb.gz
13	AFDB:S6FWN4	0.739	0.729	4.956E-82	1156	0.397	0.391	S6FWN4.pdb.gz	S6FWN4_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-1 PE=1 SV=1
14	AFDB:H2KZC3	0.523	0.527	5.184E-82	1129	0.428	0.432	H2KZC3.pdb.gz	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
15	AFDB:Q09573	0.713	0.757	3.861E-76	1070	0.372	0.396	Q09573.pdb.gz	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
16	AFDB:Q2UVJ5	0.466	0.528	8.129E-59	975	0.305	0.356	Q2UVJ5.pdb.gz	CCC1_ARATH Cation-chloride cotransporter 1 OS=Arabidopsis thaliana OX=3702 GN=CCC1 PE=1 SV=1
17	PDB:7s1xB	0.419	0.523	2.703E-42	871	0.232	0.303	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7d10A	0.346	0.851	1.154E-23	446	0.144	0.368	7d10A.pdb.gz
19	PDB:7cmhB	0.285	0.645	1.987E-8	458	0.074	0.183	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:5j4nA	0.287	0.677	3.563E-8	437	0.067	0.174	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LGD3	1116	1077	0.498	0.526	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
2	A0A0B4LHE0	1116	1066	0.508	0.543	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
3	B4DF30	1530	1079	0.663	0.700	B4DF30_HUMAN cDNA FLJ60065, highly similar to Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 PE=2 SV=1
4	C0KDV0	908	1061	0.430	0.462	C0KDV0_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
5	G5EEC9	909	1079	0.430	0.454	G5EEC9_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
6	H2KZC2	909	1102	0.430	0.445	H2KZC2_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
7	H2KZC3	908	1129	0.430	0.434	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
8	Q09573	714	1070	0.373	0.397	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
9	Q28677	1548	1085	0.665	0.699	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
10	Q5RK27	1608	1083	0.702	0.739	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
11	Q63633	2322	1139	0.982	0.982	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
12	Q8MKK5	1068	1028	0.483	0.535	Q8MKK5_DROME GH09271p OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
13	Q8MLQ5	1116	1074	0.502	0.533	Q8MLQ5_DROME Kazachoc, isoform D OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
14	Q91V14	2314	1138	0.982	0.983	S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2
15	Q924N4	1607	1150	0.687	0.681	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
16	Q9H2X9	2363	1139	1.000	1.000	S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens OX=9606 GN=SLC12A5 PE=1 SV=3
17	Q9JIS8	1551	1085	0.665	0.699	S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2
18	Q9UHW9	1604	1150	0.680	0.674	S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2
19	Q9UP95	1551	1085	0.668	0.701	S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 PE=1 SV=2
20	Q9W1G5	1115	1059	0.502	0.540	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	4.4e-56	202.1	Amino acid permease
2	PF13520 AA_permease_2	1.1e-11	56.0	Amino acid permease
3	PF03522 SLC12	1.1e-46	171.3	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455169	0.986	Neuropilin and tolloid-like protein 2
2	9606.ENSP00000337168	0.954	Band 4.1-like protein 1
3	9606.ENSP00000367265	0.934	Cytoskeleton-associated protein 4
4	9606.ENSP00000397026	0.913	Glutamate receptor ionotropic, kainate 2
5	9606.ENSP00000364893	0.824	Rho guanine nucleotide exchange factor 7
6	9606.ENSP00000346667	0.820	Serine/threonine-protein kinase WNK3
7	9606.ENSP00000410732	0.802	Gamma-aminobutyric acid receptor subunit gamma-2
8	9606.ENSP00000348278	0.787	STE20/SPS1-related proline-alanine-rich protein kinase
9	9606.ENSP00000217420	0.766	Vesicular inhibitory amino acid transporter
10	9606.ENSP00000365437	0.744	Glutamate decarboxylase 2
11	9606.ENSP00000277120	0.731	BDNF/NT-3 growth factors receptor
12	9606.ENSP00000393097	0.729	Gamma-aminobutyric acid receptor subunit alpha-1
13	9606.ENSP00000414303	0.727	Brain-derived neurotrophic factor
14	9606.ENSP00000341292	0.726	Serine/threonine-protein kinase WNK1
15	9606.ENSP00000216200	0.706	Parvalbumin alpha
16	9606.ENSP00000444596	0.700	E3 ubiquitin-protein ligase MYCBP2
17	9606.ENSP00000350928	0.696	Glutamate decarboxylase 1
18	9606.ENSP00000372390	0.685	Cationic amino acid transporter 4
19	9606.ENSP00000287766	0.681	Sodium- and chloride-dependent GABA transporter 1
20	9606.ENSP00000253329	0.679	Peptidyl-prolyl cis-trans isomerase-like 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	0.999	potassium:chloride symporter activity
GO:0005515	0.989	protein binding
GO:0015267	0.545	channel activity
GO:0008519	0.309	ammonium transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.958	localization
GO:0051234	0.926	establishment of localization
GO:0006811	0.921	monoatomic ion transport
GO:0065007	0.729	biological regulation
GO:0032501	0.601	multicellular organismal process
GO:0050896	0.444	response to stimulus
GO:0032502	0.444	developmental process
GO:0050794	0.333	regulation of cellular process
GO:0055085	0.307	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0044297	0.926	cell body
GO:0036477	0.917	somatodendritic compartment
GO:0043025	0.911	neuronal cell body
GO:0005737	0.719	cytoplasm
GO:0043226	0.717	organelle
GO:0043227	0.708	membrane-bounded organelle
GO:0042995	0.662	cell projection
GO:0120025	0.650	plasma membrane bounded cell projection
GO:0043005	0.618	neuron projection
GO:0032991	0.310	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.999	chloride(in) = chloride(out)
RHEA:29463	0.999	K(+)(in) = K(+)(out)
RHEA:28747	0.309	NH4(+)(in) = NH4(+)(out)

[back to server]