StarFunc result for job id Q9H300

User Input

>input (379 residues)
MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKV
EPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQ
YESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVF
CLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNIL
GQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIF
LPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPL
VKIWHEIRTNGPKKGGGSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H300	1.000	1.000	1.310E-53	379	1.000	1.000	Q9H300.pdb.gz	PARL_HUMAN Presenilin-associated rhomboid-like protein, mitochondrial OS=Homo sapiens OX=9606 GN=PARL PE=1 SV=2
2	AFDB:Q3B8P0	0.864	0.869	3.483E-46	377	0.894	0.899	Q3B8P0.pdb.gz	PARL_RAT Presenilin-associated rhomboid-like protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Parl PE=2 SV=1
3	AFDB:A1Z8R8	0.736	0.793	3.027E-26	351	0.367	0.396	A1Z8R8.pdb.gz	PARL_DROME Presenilins-associated rhomboid-like protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=rho-7 PE=1 SV=1
4	AFDB:O14364	0.538	0.678	1.891E-14	298	0.243	0.309	O14364.pdb.gz	YOHB_SCHPO Uncharacterized protein C13E7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13E7.11 PE=4 SV=1
5	AFDB:P53259	0.465	0.507	5.939E-13	346	0.211	0.231	P53259.pdb.gz	PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCP1 PE=1 SV=1
6	AFDB:Q9FZ81	0.474	0.531	1.409E-10	336	0.179	0.202	Q9FZ81.pdb.gz	RBL12_ARATH RHOMBOID-like protein 12, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL12 PE=2 SV=1
7	PDB:2nr9A	0.372	0.673	5.790E-5	192	0.100	0.198	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
8	AFDB:A0A1D8PFE0	0.371	0.223	8.608E-4	669	0.142	0.081	A0A1D8PFE0.pdb.gz	A0A1D8PFE0_CANAL Rbd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RBD1 PE=4 SV=1
9	PDB:3odjA	0.318	0.706	2.288E-3	157	0.082	0.197	3odjA.pdb.gz
10	AFDB:F4K139	0.140	0.113	1.420E-2	507	0.113	0.085	F4K139.pdb.gz	F4K139_ARATH CRT (Chloroquine-resistance transporter)-like transporter 1 OS=Arabidopsis thaliana OX=3702 GN=CLT1 PE=1 SV=1
11	AFDB:Q96E52	0.115	0.091	5.904E-2	524	0.142	0.103	Q96E52.pdb.gz	OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens OX=9606 GN=OMA1 PE=1 SV=1
12	AFDB:Q4QAU5	0.133	0.103	7.429E-2	600	0.145	0.092	Q4QAU5.pdb.gz	Q4QAU5_LEIMA Putative UDP-galactose transporter OS=Leishmania major OX=5664 GN=LMJF_24_0360 PE=4 SV=1
13	PDB:7czbA	0.224	0.394	4.119E-1	194	0.066	0.129	7czbA.pdb.gz
14	PDB:7yz4A	0.103	0.048	4.119E-1	1234	0.082	0.025	7yz4A.pdb.gz
15	PDB:6nq0A	0.092	0.065	9.863E-1	621	0.098	0.060	6nq0A.pdb.gz	Structural mechanisms of phospholipid activation of the human TPC2 channel.
16	PDB:5fn3B	0.158	0.190	1.185	286	0.090	0.119	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
17	PDB:8dgaA	0.110	0.040	1.185	1629	0.055	0.013	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
18	PDB:5w3sA	0.104	0.087	1.241	485	0.053	0.041	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
19	PDB:7pxeA	0.135	0.084	1.300	885	0.119	0.051	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
20	PDB:5sv0A	0.101	0.145	1.361	233	0.055	0.090	5sv0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3B8P0	0.0	696	377	0.894	0.899	PARL_RAT Presenilin-associated rhomboid-like protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Parl PE=2 SV=1
2	Q5XJY4	0.0	704	377	0.905	0.910	PARL_MOUSE Presenilin-associated rhomboid-like protein, mitochondrial OS=Mus musculus OX=10090 GN=Parl PE=1 SV=1
3	Q9H300	0.0	781	379	1.000	1.000	PARL_HUMAN Presenilin-associated rhomboid-like protein, mitochondrial OS=Homo sapiens OX=9606 GN=PARL PE=1 SV=2
4	A1Z8R8	1.76e-87	270	351	0.356	0.385	PARL_DROME Presenilins-associated rhomboid-like protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=rho-7 PE=1 SV=1
5	O14364	2.17e-29	117	298	0.214	0.272	YOHB_SCHPO Uncharacterized protein C13E7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13E7.11 PE=4 SV=1
6	P53259	1.05e-22	99.8	346	0.164	0.179	PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCP1 PE=1 SV=1
7	Q9FZ81	4.39e-10	62.8	336	0.187	0.211	RBL12_ARATH RHOMBOID-like protein 12, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL12 PE=2 SV=1
8	F4ICF4	0.003	41.6	343	0.098	0.108	RBL10_ARATH RHOMBOID-like protein 10, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBL10 PE=2 SV=1
9	Q9P7D8	0.013	39.7	392	0.053	0.051	YOFA_SCHPO Uncharacterized rhomboid protein P4H10.10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP4H10.10 PE=3 SV=1
10	Q84MB5	0.049	37.7	280	0.103	0.139	RBL11_ARATH Rhomboid-like protein 11, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RBL11 PE=1 SV=1
11	Q14669	0.92	34.3	1992	0.053	0.010	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
12	G5E870	0.97	34.3	2025	0.053	0.010	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
13	A0A0H2US45	2.7	32.0	225	0.042	0.071	A0A0H2US45_STRPN Peptidase S54 rhomboid domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_2094 PE=1 SV=1
14	Q9C9M8	3.0	32.3	482	0.050	0.039	DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana OX=3702 GN=DTX9 PE=2 SV=1
15	Q0WQX7	3.2	32.3	389	0.098	0.095	RBL1_ARATH RHOMBOID-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBL1 PE=2 SV=1
16	Q9SGS2	8.7	30.8	338	0.042	0.047	HMGB9_ARATH High mobility group B protein 9 OS=Arabidopsis thaliana OX=3702 GN=HMGB9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01694 Rhomboid	2.4e-27	107.2	Rhomboid family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364204	0.963	Serine/threonine-protein kinase PINK1, mitochondrial
2	9606.ENSP00000318480	0.957	ATP-dependent zinc metalloprotease YME1L1
3	9606.ENSP00000327467	0.902	Essential MCU regulator, mitochondrial
4	9606.ENSP00000329002	0.889	HCLS1-associated protein X-1
5	9606.ENSP00000258080	0.881	Serine protease HTRA2, mitochondrial
6	9606.ENSP00000269143	0.856	AFG3-like protein 2
7	9606.ENSP00000289248	0.854	Rhomboid-related protein 2
8	9606.ENSP00000354681	0.851	Dynamin-like 120 kDa protein, mitochondrial
9	9606.ENSP00000420617	0.847	Mitofusin-1
10	9606.ENSP00000360270	0.843	Metalloendopeptidase OMA1, mitochondrial
11	9606.ENSP00000268704	0.841	Paraplegin
12	9606.ENSP00000344206	0.839	Rhomboid-related protein 1
13	9606.ENSP00000348886	0.836	Stomatin-like protein 2, mitochondrial
14	9606.ENSP00000235329	0.833	Mitofusin-2
15	9606.ENSP00000269051	0.817	Rhomboid-related protein 3
16	9606.ENSP00000223136	0.781	Mitochondrial fission 1 protein
17	9606.ENSP00000322775	0.767	Inactive rhomboid protein 2
18	9606.ENSP00000262316	0.749	Inactive rhomboid protein 1
19	9606.ENSP00000441875	0.742	Prohibitin-2
20	9606.ENSP00000326366	0.741	Presenilin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004175	1.000	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0008152	0.994	metabolic process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0010821	0.959	regulation of mitochondrion organization
GO:1901564	0.937	organonitrogen compound metabolic process
GO:0043170	0.934	macromolecule metabolic process
GO:0009894	0.927	regulation of catabolic process
GO:0007005	0.917	mitochondrion organization
GO:0019538	0.908	protein metabolic process
GO:0006508	0.887	proteolysis
GO:0010639	0.882	negative regulation of organelle organization
GO:0031323	0.828	regulation of cellular metabolic process
GO:0050896	0.808	response to stimulus
GO:0010646	0.766	regulation of cell communication
GO:0048583	0.758	regulation of response to stimulus
GO:0023051	0.757	regulation of signaling
GO:0042981	0.728	regulation of apoptotic process
GO:0060548	0.633	negative regulation of cell death
GO:0009966	0.535	regulation of signal transduction
GO:0032879	0.400	regulation of localization
GO:0048518	0.359	positive regulation of biological process
GO:0043069	0.346	negative regulation of programmed cell death
GO:0043066	0.342	negative regulation of apoptotic process
GO:0051716	0.336	cellular response to stimulus
GO:0048522	0.329	positive regulation of cellular process
GO:0031329	0.315	regulation of cellular catabolic process
GO:2001233	0.315	regulation of apoptotic signaling pathway
GO:0060255	0.314	regulation of macromolecule metabolic process
GO:0080090	0.311	regulation of primary metabolic process
GO:0010506	0.310	regulation of autophagy
GO:0048284	0.309	organelle fusion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.998	organelle membrane
GO:0031967	0.998	organelle envelope
GO:0005743	0.985	mitochondrial inner membrane
GO:0043233	0.813	organelle lumen
GO:0070013	0.800	intracellular organelle lumen
GO:0005634	0.718	nucleus
GO:0031981	0.426	nuclear lumen
GO:0032991	0.350	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]