StarFunc result for job id Q9H305

User Input

>input (208 residues)
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHP
MPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSG
AATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLI
PCLINDFKDVTHTCPSCKAYIYTYKRLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H305	0.999	0.999	1.119E-32	208	1.000	1.000	Q9H305.pdb.gz	CDIP1_HUMAN Cell death-inducing p53-target protein 1 OS=Homo sapiens OX=9606 GN=CDIP1 PE=1 SV=1
2	AFDB:Q54HX8	0.275	0.310	7.165E-7	181	0.303	0.348	Q54HX8.pdb.gz	CDIP1_DICDI Cell death-inducing p53-target protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=litaf PE=3 SV=1
3	PDB:7vbcI	0.126	0.204	1.229	107	0.077	0.150	7vbcI.pdb.gz	Structure of the human RNA polymerase I elongation complex.
4	PDB:5apno	0.149	0.256	1.316	105	0.077	0.152	5apno.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
5	AFDB:Q96K62	0.077	0.039	1.678	511	0.255	0.104	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
6	PDB:4btsA9	0.119	0.237	1.986	93	0.053	0.118	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
7	PDB:4v6wCo	0.149	0.277	3.679	104	0.062	0.125	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.
8	AFDB:Q9BYE2	0.086	0.036	5.025	586	0.163	0.058	Q9BYE2.pdb.gz	TMPSD_HUMAN Transmembrane protease serine 13 OS=Homo sapiens OX=9606 GN=TMPRSS13 PE=1 SV=5
9	PDB:5aj0Ao	0.124	0.224	6.366	105	0.058	0.114	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
10	PDB:5iy6I	0.146	0.224	6.818	125	0.038	0.064	5iy6I.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
11	PDB:6fyxm	0.083	0.113	7.301	147	0.053	0.075	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
12	AFDB:Q17RL8	0.097	0.033	8.119	775	0.149	0.040	Q17RL8.pdb.gz	Q17RL8_HUMAN HCG2004980, isoform CRA_e OS=Homo sapiens OX=9606 GN=PDZD4 PE=1 SV=1
13	AFDB:Q5TJ57	0.088	0.021	8.695	1561	0.135	0.018	Q5TJ57.pdb.gz	FORE_DICDI Formin-E OS=Dictyostelium discoideum OX=44689 GN=forE PE=1 SV=1
14	PDB:1flgA	0.098	0.036	8.968	582	0.010	0.003	1flgA.pdb.gz	X-ray structure of the quinoprotein ethanol dehydrogenase from Pseudomonas aeruginosa: basis of substrate specificity.
15	PDB:5aj0Bf	0.113	0.227	8.968	73	0.058	0.164	5aj0Bf.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:7ajtUO	0.083	0.036	8.968	493	0.019	0.008	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H305	4.26e-144	401	208	1.000	1.000	CDIP1_HUMAN Cell death-inducing p53-target protein 1 OS=Homo sapiens OX=9606 GN=CDIP1 PE=1 SV=1
2	Q9JLJ0	1.42e-17	78.2	161	0.183	0.236	LITAF_MOUSE Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1
3	P0C0T0	2.23e-17	77.8	161	0.178	0.230	LITAF_RAT Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Rattus norvegicus OX=10116 GN=Litaf PE=2 SV=1
4	Q8QGW7	1.22e-15	72.8	148	0.317	0.446	LITAF_CHICK Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Gallus gallus OX=9031 GN=LITAF PE=2 SV=1
5	Q99732	2.73e-15	72.4	161	0.207	0.267	LITAF_HUMAN Lipopolysaccharide-induced tumor necrosis factor-alpha factor OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=2
6	Q54HX8	1.25e-14	70.9	181	0.154	0.177	CDIP1_DICDI Cell death-inducing p53-target protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=litaf PE=3 SV=1
7	I3L3U8	6.45e-12	63.2	153	0.183	0.248	I3L3U8_HUMAN Lipopolysaccharide induced TNF factor (Fragment) OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=8
8	Q9W1P0	1.24e-07	50.4	114	0.106	0.193	Q9W1P0_DROME FI16602p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13559 PE=2 SV=1
9	I3L1I9	1.54e-05	45.4	137	0.149	0.226	I3L1I9_HUMAN Lipopolysaccharide induced TNF factor (Fragment) OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=1
10	G5EGQ9	2.50e-05	46.6	1025	0.101	0.020	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
11	Q9XWU3	6.69e-05	42.7	101	0.135	0.277	Q9XWU3_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y41C4A.11 PE=3 SV=2
12	P25439	0.017	38.1	1638	0.111	0.014	BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2
13	Q5JRA6	0.023	37.7	1907	0.226	0.025	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
14	M9PC23	0.037	37.4	7962	0.144	0.004	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	M9MRD6	0.041	37.0	11999	0.144	0.003	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	M9MRF5	0.041	37.0	11986	0.144	0.003	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
17	M9PCM8	0.041	37.0	11917	0.144	0.003	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	A0A1D8PFP3	0.043	37.0	1504	0.111	0.015	A0A1D8PFP3_CANAL 5'-3' exoribonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEM1 PE=3 SV=1
19	Q9UQ16	0.090	35.8	869	0.120	0.029	DYN3_HUMAN Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4
20	Q9W221	0.11	34.3	129	0.144	0.233	Q9W221_DROME MIP04282p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13510 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19079 CFSR	3.2e+02	13.0	Collagen-flanked surface repeat
2	PF14353 CpXC	78	14.8	CpXC protein
3	PF17848 zf-ACC	5.8e+02	12.1	Acetyl-coA carboxylase zinc finger domain
4	PF10601 zf-LITAF-like	2.4e-19	80.7	LITAF-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392330	0.943	B-cell receptor-associated protein 31
2	9606.ENSP00000372482	0.783	Small nuclear ribonucleoprotein U11/U12 subunit 25
3	9606.ENSP00000483814	0.720	GATOR complex protein NPRL3
4	9606.ENSP00000323687	0.706	(E3-independent) E2 ubiquitin-conjugating enzyme
5	9606.ENSP00000293860	0.699	DNA-directed RNA polymerase III subunit RPC10
6	9606.ENSP00000322775	0.691	Inactive rhomboid protein 2
7	9606.ENSP00000312066	0.685	Signal recognition particle subunit SRP68
8	9606.ENSP00000350698	0.672	Probable ATP-dependent RNA helicase DDX47
9	9606.ENSP00000262316	0.634	Inactive rhomboid protein 1
10	9606.ENSP00000301607	0.625	Envoplakin
11	9606.ENSP00000262370	0.624	E3 ubiquitin-protein ligase MGRN1
12	9606.ENSP00000416683	0.614	Insulin-like growth factor-binding protein complex acid labile subunit
13	9606.ENSP00000380762	0.612	CST complex subunit TEN1
14	9606.ENSP00000359819	0.609	Motile sperm domain-containing protein 1
15	9606.ENSP00000337731	0.588	Cell death activator CIDE-B
16	9606.ENSP00000279907	0.571	UHRF1-binding protein 1-like
17	9606.ENSP00000229002	0.569	Ras-related and estrogen-regulated growth inhibitor-like protein
18	9606.ENSP00000307208	0.566	Nucleosome-remodeling factor subunit BPTF
19	9606.ENSP00000377725	0.561	Zinc finger protein with KRAB and SCAN domains 5
20	9606.ENSP00000299575	0.549	ATM interactor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0007154	0.955	cell communication
GO:0007165	0.947	signal transduction
GO:0006950	0.914	response to stress
GO:0008219	0.869	cell death
GO:0097190	0.822	apoptotic signaling pathway
GO:0097193	0.797	intrinsic apoptotic signaling pathway
GO:0072331	0.751	signal transduction by p53 class mediator
GO:0033554	0.710	cellular response to stress
GO:0008630	0.699	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0072332	0.668	intrinsic apoptotic signaling pathway by p53 class mediator
GO:0042771	0.532	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0019222	0.350	regulation of metabolic process
GO:0048518	0.337	positive regulation of biological process
GO:0060255	0.318	regulation of macromolecule metabolic process
GO:0008152	0.314	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005634	0.999	nucleus
GO:0031410	0.995	cytoplasmic vesicle
GO:0005765	0.995	lysosomal membrane
GO:0010008	0.985	endosome membrane
GO:0031902	0.980	late endosome membrane
GO:0098552	0.963	side of membrane
GO:0098562	0.941	cytoplasmic side of membrane
GO:0031974	0.857	membrane-enclosed lumen
GO:0070013	0.849	intracellular organelle lumen
GO:0031981	0.787	nuclear lumen
GO:0005654	0.746	nucleoplasm
GO:0010009	0.705	cytoplasmic side of endosome membrane
GO:0071944	0.691	cell periphery
GO:0098574	0.690	cytoplasmic side of lysosomal membrane
GO:0098560	0.690	cytoplasmic side of late endosome membrane
GO:0005886	0.616	plasma membrane
GO:0005829	0.564	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]