StarFunc result for job id Q9H313

User Input

>input (450 residues)
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLI
FIAVYLIRFCCCRPPEPPGSKIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVS
QLSSALLHANHTLSTIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE
AAAQQLQGLAFWQGVPLSPLQVAENVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK
WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYY
LLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN
FHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF
PPSDDYDDTDDDDPFNPQESKRFVQWQSSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D3A9	0.982	0.982	1.099E-55	450	0.916	0.916	Q9D3A9.pdb.gz	TTYH1_MOUSE Protein tweety homolog 1 OS=Mus musculus OX=10090 GN=Ttyh1 PE=1 SV=1
2	PDB:7p5jA	0.866	0.975	2.489E-44	399	0.884	0.997	7p5jA.pdb.gz
3	AFDB:Q9BSA4	0.905	0.768	5.560E-32	534	0.416	0.350	Q9BSA4.pdb.gz	TTYH2_HUMAN Protein tweety homolog 2 OS=Homo sapiens OX=9606 GN=TTYH2 PE=1 SV=3
4	AFDB:Q9C0H2	0.904	0.781	5.848E-30	523	0.367	0.315	Q9C0H2.pdb.gz	TTYH3_HUMAN Protein tweety homolog 3 OS=Homo sapiens OX=9606 GN=TTYH3 PE=1 SV=3
5	PDB:7p54A	0.854	0.965	3.410E-28	397	0.378	0.428	7p54A.pdb.gz
6	PDB:7p5cA	0.848	0.971	3.420E-27	392	0.353	0.406	7p5cA.pdb.gz
7	AFDB:Q9W5A5	0.796	0.561	7.547E-19	655	0.231	0.159	Q9W5A5.pdb.gz	TTY2_DROME Protein tweety-2 OS=Drosophila melanogaster OX=7227 GN=CG3638 PE=1 SV=2
8	AFDB:Q8H0U2	0.478	0.417	9.740E-8	541	0.147	0.122	Q8H0U2.pdb.gz	Q8H0U2_ARATH Plasma membrane fusion protein OS=Arabidopsis thaliana OX=3702 GN=At2g12400 PE=1 SV=1
9	AFDB:Q1PF01	0.423	0.364	1.068E-6	545	0.136	0.112	Q1PF01.pdb.gz	Q1PF01_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At2g25270 PE=1 SV=1
10	AFDB:Q3UUY6	0.313	0.187	7.875E-5	835	0.187	0.101	Q3UUY6.pdb.gz	PROM2_MOUSE Prominin-2 OS=Mus musculus OX=10090 GN=Prom2 PE=1 SV=1
11	AFDB:Q8CJ52	0.302	0.183	7.875E-5	834	0.180	0.097	Q8CJ52.pdb.gz	PROM2_RAT Prominin-2 OS=Rattus norvegicus OX=10116 GN=Prom2 PE=1 SV=1
12	AFDB:Q8N271	0.313	0.188	8.232E-5	834	0.202	0.109	Q8N271.pdb.gz	PROM2_HUMAN Prominin-2 OS=Homo sapiens OX=9606 GN=PROM2 PE=1 SV=1
13	AFDB:P96258	0.160	0.162	4.062E-4	439	0.147	0.150	P96258.pdb.gz	P96258_MYCTU Possible conserved membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0412c PE=1 SV=2
14	PDB:6x15A	0.100	0.105	5.261E-2	419	0.116	0.124	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
15	PDB:6lr0U	0.148	0.064	5.749E-2	1230	0.093	0.034	6lr0U.pdb.gz
16	PDB:2wsxA	0.107	0.099	7.841E-2	496	0.151	0.137	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
17	PDB:4f4cA	0.100	0.047	8.196E-2	1250	0.084	0.030	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
18	PDB:6xz6A	0.124	0.237	8.568E-2	213	0.078	0.164	6xz6A.pdb.gz
19	PDB:1t72A	0.174	0.322	8.956E-2	215	0.071	0.149	1t72A.pdb.gz
20	PDB:7ungA1	0.137	0.156	1.222E-1	391	0.084	0.097	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D3A9	0.0	689	450	0.916	0.916	TTYH1_MOUSE Protein tweety homolog 1 OS=Mus musculus OX=10090 GN=Ttyh1 PE=1 SV=1
2	Q9H313	0.0	904	450	1.000	1.000	TTYH1_HUMAN Protein tweety homolog 1 OS=Homo sapiens OX=9606 GN=TTYH1 PE=1 SV=1
3	Q9BSA4	9.50e-97	302	534	0.409	0.345	TTYH2_HUMAN Protein tweety homolog 2 OS=Homo sapiens OX=9606 GN=TTYH2 PE=1 SV=3
4	Q9C0H2	7.90e-84	268	523	0.360	0.310	TTYH3_HUMAN Protein tweety homolog 3 OS=Homo sapiens OX=9606 GN=TTYH3 PE=1 SV=3
5	Q9W5A5	2.55e-17	86.7	655	0.262	0.180	TTY2_DROME Protein tweety-2 OS=Drosophila melanogaster OX=7227 GN=CG3638 PE=1 SV=2
6	Q7YU59	0.18	37.0	1287	0.084	0.030	Q7YU59_DROME RE56428p OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
7	Q9U5W1	0.18	37.0	1287	0.084	0.030	Q9U5W1_DROME NPC1 protein OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
8	Q9VL24	0.18	37.0	1287	0.084	0.030	Q9VL24_DROME Niemann-Pick type C-1a, isoform A OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=2
9	X2J9B0	0.20	36.6	1283	0.084	0.030	X2J9B0_DROME Niemann-Pick type C-1a, isoform E OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=1
10	P0AB89	2.4	33.1	456	0.062	0.061	PUR8_ECOLI Adenylosuccinate lyase OS=Escherichia coli (strain K12) OX=83333 GN=purB PE=1 SV=1
11	O75311	5.3	32.0	464	0.076	0.073	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
12	A0A8J8Y6U2	5.7	32.0	474	0.029	0.027	A0A8J8Y6U2_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx19a PE=1 SV=1
13	Q68FX3	5.8	32.0	478	0.029	0.027	Q68FX3_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx19a PE=2 SV=1
14	P24524	6.1	31.6	464	0.076	0.073	GLRA3_RAT Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1
15	Q91XP5	6.1	31.6	464	0.076	0.073	GLRA3_MOUSE Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2
16	A0A0G2JY21	6.6	31.6	437	0.029	0.030	A0A0G2JY21_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx19b PE=1 SV=2
17	A0A0G2K7X6	6.8	31.6	481	0.029	0.027	A0A0G2K7X6_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx19b PE=1 SV=2
18	Q28139	9.2	31.2	1216	0.049	0.018	NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02203 TarH	5.1e+02	12.0	Tar ligand binding domain homologue
2	PF04906 Tweety	1.7e-171	582.3	Tweety

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008953848.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003830221.1	0.675	Leukocyte receptor cluster member 8
2	9597.XP_008953849.1	0.668	Leukocyte receptor cluster member 9
3	9597.XP_003830199.1	0.653	V-set and transmembrane domain-containing protein 1
4	9597.XP_008953860.1	0.653	Calcium voltage-gated channel auxiliary subunit gamma 8
5	9597.XP_003822374.2	0.591	Cerebral endothelial cell adhesion molecule
6	9597.XP_008957650.1	0.564	Retention in endoplasmic reticulum sorting receptor 1
7	9597.XP_008952131.1	0.521	Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
8	9597.XP_003830213.1	0.506	Leukocyte associated immunoglobulin like receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0015318	0.981	inorganic molecular entity transmembrane transporter activity
GO:0005216	0.980	monoatomic ion channel activity
GO:0008509	0.978	monoatomic anion transmembrane transporter activity
GO:1901702	0.976	salt transmembrane transporter activity
GO:0005254	0.967	chloride channel activity
GO:0043169	0.933	cation binding
GO:0046872	0.905	metal ion binding
GO:0005509	0.889	calcium ion binding
GO:0005225	0.500	volume-sensitive anion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051179	0.989	localization
GO:0015698	0.984	inorganic anion transport
GO:0006820	0.984	monoatomic anion transport
GO:0055085	0.975	transmembrane transport
GO:0006821	0.935	chloride transport
GO:0034220	0.893	monoatomic ion transmembrane transport
GO:0071840	0.659	cellular component organization or biogenesis
GO:0016043	0.646	cellular component organization
GO:0044085	0.436	cellular component biogenesis
GO:0046847	0.428	filopodium assembly
GO:0007155	0.411	cell adhesion
GO:0031589	0.383	cell-substrate adhesion
GO:0065007	0.349	biological regulation
GO:0007049	0.306	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.856	endomembrane system
GO:0005622	0.772	intracellular anatomical structure
GO:0043227	0.729	membrane-bounded organelle
GO:0043229	0.661	intracellular organelle
GO:0005737	0.553	cytoplasm
GO:0043231	0.540	intracellular membrane-bounded organelle
GO:0031090	0.537	organelle membrane
GO:0098590	0.464	plasma membrane region
GO:0098588	0.447	bounding membrane of organelle
GO:0042995	0.357	cell projection
GO:0120025	0.353	plasma membrane bounded cell projection
GO:0005783	0.327	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.968	chloride(in) = chloride(out)

[back to server]