StarFunc result for job id Q9H324

User Input

>input (1103 residues)
MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGATAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQASTSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRSPEESGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT
LGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREVQCSEFDSIPFRGKFYKWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPGAG
YEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ
GPDQVQSLEALGPINASLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSC
GPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCG
VGQRQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDGPEECKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCHGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1A5	0.689	0.681	0.000	1117	0.597	0.590	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	AFDB:E7FEJ5	0.501	0.451	0.000	1244	0.368	0.326	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
3	AFDB:E7FFX0	0.513	0.467	0.000	1224	0.369	0.333	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
4	AFDB:Q4VC17	0.580	0.533	0.000	1219	0.377	0.341	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
5	AFDB:Q69Z28	0.512	0.469	0.000	1222	0.370	0.334	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
6	AFDB:Q8TE60	0.561	0.513	0.000	1221	0.367	0.332	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
7	AFDB:Q9H324	1.000	1.000	0.000	1103	1.000	1.000	Q9H324.pdb.gz	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
8	AFDB:Q811B3	0.597	0.420	1.397E-98	1600	0.348	0.240	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	AFDB:E9PUN6	0.566	0.334	5.344E-98	1931	0.346	0.198	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
10	AFDB:Q9P2N4	0.546	0.325	5.344E-98	1935	0.346	0.197	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
11	PDB:4q1lA	0.166	0.837	5.635E-13	202	0.055	0.302	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.078	0.167	8.302E-9	442	0.063	0.158	1w0rA.pdb.gz
13	PDB:2x7mA	0.120	0.590	2.652E-4	180	0.028	0.172	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
14	PDB:2n6fA	0.041	0.184	8.689E-4	136	0.025	0.206	2n6fA.pdb.gz
15	PDB:7nycC	0.045	0.057	2.568E-3	809	0.040	0.054	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4a5wB	0.051	0.061	2.704E-3	871	0.024	0.031	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
17	PDB:3t5oA	0.048	0.059	3.324E-3	871	0.024	0.031	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
18	PDB:7nydE	0.062	0.124	3.685E-3	484	0.064	0.147	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:6dldD	0.041	0.132	6.501E-3	269	0.029	0.119	6dldD.pdb.gz
20	PDB:4e0sB	0.047	0.057	6.845E-3	898	0.034	0.041	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	1409	1117	0.606	0.598	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	D3ZLL7	0.0	671	1221	0.356	0.322	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
3	E7FEJ5	0.0	657	1244	0.363	0.322	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	E7FFX0	0.0	617	1224	0.348	0.314	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
5	P58397	0.0	614	1594	0.337	0.233	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
6	Q4VC17	0.0	673	1219	0.363	0.328	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
7	Q68SA9	0.0	644	1657	0.350	0.233	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
8	Q69Z28	0.0	660	1222	0.352	0.318	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
9	Q811B3	0.0	631	1600	0.342	0.236	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
10	Q8TE60	0.0	679	1221	0.356	0.322	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
11	Q9H324	0.0	2272	1103	1.000	1.000	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
12	Q9UKP4	0.0	647	1686	0.364	0.238	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
13	Q9UKP5	0.0	1412	1117	0.607	0.600	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
14	A0A286YEC9	1.34e-177	530	468	0.235	0.553	A0A286YEC9_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
15	Q9P2N4	2.24e-176	567	1935	0.350	0.199	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
16	P59510	2.72e-175	564	1910	0.338	0.195	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
17	E9PUN6	2.84e-172	556	1931	0.348	0.199	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
18	P59511	2.17e-171	553	1906	0.345	0.199	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
19	F1SFS3	3.68e-160	524	2000	0.342	0.189	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
20	P79331	1.66e-154	493	1205	0.321	0.294	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	7.5e-13	60.1	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	5.9e-07	40.9	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	8.9e-17	72.8	ADAM-TS Spacer 1
4	PF00781 DAGK_cat	5.8e+02	11.5	Diacylglycerol kinase catalytic domain
5	PF16313 DUF4953	2.1e+02	12.5	Met-zincin
6	PF01562 Pep_M12B_propep	6.9e-29	112.4	Reprolysin family propeptide
7	PF08686 PLAC	2.2e-05	36.4	PLAC (protease and lacunin) domain
8	PF01421 Reprolysin	3e-21	87.8	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	9.4e-07	40.4	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	5.3e-08	44.8	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	0.00086	30.5	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	5.5e-10	51.3	Metallo-peptidase family M12
13	PF19030 TSP1_ADAMTS	9.7e-42	152.4	Thrombospondin type 1 domain
14	PF19035 TSP1_CCN	0.0004	32.0	CCN3 Nov like TSP1 domain
15	PF19028 TSP1_spondin	0.12	24.0	Spondin-like TSP1 domain
16	PF00090 TSP_1	6.8e-13	59.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270328

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.949	Beta-1,3-glucosyltransferase
2	9606.ENSP00000339613	0.945	GDP-fucose protein O-fucosyltransferase 2
3	9606.ENSP00000346478	0.938	ADAMTS-like protein 2
4	9606.ENSP00000358035	0.934	ADAMTS-like protein 4
5	9606.ENSP00000347484	0.930	Thrombospondin type-1 domain-containing protein 4
6	9606.ENSP00000360997	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 13
7	9606.ENSP00000286744	0.924	ADAMTS-like protein 3
8	9606.ENSP00000260356	0.923	Thrombospondin-1
9	9606.ENSP00000325527	0.923	Fibrillin-1
10	9606.ENSP00000327608	0.922	ADAMTS-like protein 5
11	9606.ENSP00000369921	0.922	ADAMTS-like protein 1
12	9606.ENSP00000268070	0.919	ADAM metallopeptidase with thrombospondin type 1 motif 17
13	9606.ENSP00000362304	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 14
14	9606.ENSP00000251582	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 2
15	9606.ENSP00000257359	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 8
16	9606.ENSP00000274487	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 19
17	9606.ENSP00000284987	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 5
18	9606.ENSP00000284984	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 1
19	9606.ENSP00000299164	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 15
20	9606.ENSP00000356975	0.912	A disintegrin and metalloproteinase with thrombospondin motifs 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008233	0.995	peptidase activity
GO:0008237	0.955	metallopeptidase activity
GO:0004222	0.330	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0071704	0.913	organic substance metabolic process
GO:0043170	0.891	macromolecule metabolic process
GO:0006807	0.851	nitrogen compound metabolic process
GO:0044238	0.832	primary metabolic process
GO:0050789	0.829	regulation of biological process
GO:1901564	0.815	organonitrogen compound metabolic process
GO:0071840	0.791	cellular component organization or biogenesis
GO:0016043	0.777	cellular component organization
GO:0019538	0.722	protein metabolic process
GO:0032502	0.647	developmental process
GO:0032501	0.645	multicellular organismal process
GO:0048856	0.634	anatomical structure development
GO:0050794	0.625	regulation of cellular process
GO:0007275	0.564	multicellular organism development
GO:0048519	0.442	negative regulation of biological process
GO:0048731	0.419	system development
GO:0050896	0.388	response to stimulus
GO:0030198	0.300	extracellular matrix organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0043226	0.956	organelle
GO:0005622	0.937	intracellular anatomical structure
GO:0043227	0.930	membrane-bounded organelle
GO:0043231	0.916	intracellular membrane-bounded organelle
GO:0005576	0.913	extracellular region
GO:0099080	0.846	supramolecular complex
GO:0043233	0.757	organelle lumen
GO:0070013	0.743	intracellular organelle lumen
GO:0099512	0.545	supramolecular fiber
GO:0005737	0.531	cytoplasm
GO:0001527	0.516	microfibril
GO:0012505	0.506	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.995	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.330	Metalloendopeptidases.

[back to server]