StarFunc result for job id Q9H329

User Input

>input (900 residues)
MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFP
AGGGPLLTGGAAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDL
VETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYL
FVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAME
FDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFE
GANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVE
HHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSS
SDRLPFGIEENGGTPFLTAASGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSS
KSLTKLSPGTPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLL
PSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQ
PAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTSTTTNTTTAATQVSVPLPSPK
VQNVSSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFTEATPLAEPASNPHCAHSR
CSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTFTTGPQFTADFRDSKLQCC
PGPTSPLIPAATLRPLTETVSTVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H329	0.999	0.999	0.000	900	1.000	1.000	Q9H329.pdb.gz	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2
2	AFDB:Q9JMC8	0.404	0.687	2.503E-78	527	0.516	0.880	Q9JMC8.pdb.gz	E41LB_MOUSE Band 4.1-like protein 4B OS=Mus musculus OX=10090 GN=Epb41l4b PE=1 SV=2
3	AFDB:F6NJ58	0.417	0.477	5.185E-60	783	0.377	0.433	F6NJ58.pdb.gz
4	AFDB:Q58CU2	0.386	0.688	1.059E-58	502	0.314	0.564	Q58CU2.pdb.gz	E41L5_BOVIN Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=EPB41L5 PE=1 SV=1
5	AFDB:Q9HCM4	0.391	0.479	6.468E-58	733	0.362	0.445	Q9HCM4.pdb.gz	E41L5_HUMAN Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN=EPB41L5 PE=1 SV=3
6	AFDB:Q8BGS1	0.391	0.479	1.119E-57	731	0.368	0.453	Q8BGS1.pdb.gz	E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1
7	AFDB:A0T1Z4	0.386	0.373	1.396E-55	932	0.344	0.333	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
8	AFDB:A0A0A0MRA8	0.355	0.348	1.340E-39	918	0.231	0.227	A0A0A0MRA8.pdb.gz	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
9	AFDB:E9PHY5	0.355	0.342	4.243E-38	935	0.226	0.217	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
10	AFDB:Q9H4G0	0.353	0.361	4.243E-38	881	0.229	0.234	Q9H4G0.pdb.gz	E41L1_HUMAN Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2
11	PDB:4rm8A	0.289	0.684	4.503E-21	368	0.093	0.228	4rm8A.pdb.gz
12	PDB:6r9tA	0.161	0.072	5.086E-7	2185	0.044	0.018	6r9tA.pdb.gz
13	PDB:7c3mA	0.252	0.382	5.372E-7	577	0.063	0.099	7c3mA.pdb.gz
14	PDB:5itdA	0.083	0.076	4.827E-4	995	0.042	0.038	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:6u3eA	0.100	0.187	1.226E-3	397	0.029	0.065	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:7lq1A	0.086	0.081	1.368E-3	950	0.016	0.015	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
17	PDB:6pyuA	0.081	0.079	1.527E-3	930	0.040	0.039	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
18	PDB:7rbsB	0.079	0.408	1.527E-3	157	0.022	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
19	PDB:2y3aA	0.089	0.082	1.800E-3	976	0.032	0.030	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
20	PDB:5swpA	0.084	0.072	2.368E-3	1060	0.019	0.016	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q58CU2	0.0	578	502	0.312	0.560	E41L5_BOVIN Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=EPB41L5 PE=1 SV=1
2	Q6NYK4	0.0	551	772	0.354	0.413	Q6NYK4_DANRE Band 4.1-like protein 5 OS=Danio rerio OX=7955 GN=dZ104F18.2 PE=1 SV=1
3	Q8BGS1	0.0	590	731	0.313	0.386	E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1
4	Q9H329	0.0	1864	900	1.000	1.000	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2
5	Q9HCM4	0.0	608	733	0.379	0.465	E41L5_HUMAN Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN=EPB41L5 PE=1 SV=3
6	Q9JMC8	0.0	941	527	0.523	0.894	E41LB_MOUSE Band 4.1-like protein 4B OS=Mus musculus OX=10090 GN=Epb41l4b PE=1 SV=2
7	A0T1Z5	1.12e-160	491	786	0.241	0.276	A0T1Z5_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
8	B7Z0J2	1.66e-160	495	919	0.241	0.236	B7Z0J2_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=4 SV=1
9	Q9VFU8	5.15e-160	495	972	0.241	0.223	Q9VFU8_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
10	A0T1Z4	5.36e-160	494	932	0.241	0.233	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
11	E9PII3	2.93e-81	279	706	0.177	0.225	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
12	E9PK52	1.51e-80	279	811	0.177	0.196	E9PK52_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
13	A0A2R8Y5B3	1.93e-80	279	824	0.177	0.193	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
14	E9PHY5	3.30e-80	281	935	0.179	0.172	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
15	O43491	8.81e-80	281	1005	0.179	0.160	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
16	A8K968	2.75e-79	275	756	0.158	0.188	A8K968_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
17	A0A8I5ZZJ7	8.74e-79	275	835	0.158	0.170	A0A8I5ZZJ7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
18	A0A0A0MRA8	1.44e-78	276	918	0.158	0.155	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
19	A3E0T0	1.94e-78	275	870	0.158	0.163	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
20	A0A8I5ZVK0	2.47e-78	275	888	0.158	0.160	A0A8I5ZVK0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00887 ACBP	18	17.1	Acyl CoA binding protein
2	PF08736 FA	3e-09	48.0	FERM adjacent (FA)
3	PF09380 FERM_C	7.8e-17	72.8	FERM C-terminal PH-like domain
4	PF00373 FERM_M	1.2e-16	72.6	FERM central domain
5	PF09379 FERM_N	2.1e-19	80.5	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352995	0.944	Rho guanine nucleotide exchange factor 18
2	9606.ENSP00000295797	0.897	Protein kinase C iota type
3	9606.ENSP00000367830	0.857	Protein kinase C zeta type
4	9606.ENSP00000275216	0.819	Trace amine-associated receptor 1
5	9606.ENSP00000471635	0.702	Uncharacterized protein
6	9606.ENSP00000343925	0.646	Estrogen receptor beta
7	9606.ENSP00000217133	0.645	Tubulin beta-1 chain
8	9606.ENSP00000381984	0.624	Regulation of nuclear pre-mRNA domain-containing protein 1A
9	9606.ENSP00000303469	0.532	Olfactory receptor 52A5
10	9606.ENSP00000300061	0.521	Amiloride-sensitive sodium channel subunit gamma
11	9606.ENSP00000261681	0.517	MAGUK p55 subfamily member 5
12	9606.ENSP00000219255	0.506	Partitioning defective 6 homolog alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005200	1.000	structural constituent of cytoskeleton
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0048522	0.989	positive regulation of cellular process
GO:0071840	0.937	cellular component organization or biogenesis
GO:0016043	0.927	cellular component organization
GO:0050896	0.716	response to stimulus
GO:0060255	0.672	regulation of macromolecule metabolic process
GO:0040012	0.599	regulation of locomotion
GO:0032501	0.475	multicellular organismal process
GO:0030155	0.474	regulation of cell adhesion
GO:0051239	0.456	regulation of multicellular organismal process
GO:0010468	0.453	regulation of gene expression
GO:0030334	0.443	regulation of cell migration
GO:0048856	0.430	anatomical structure development
GO:0006996	0.415	organelle organization
GO:0010604	0.326	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.995	plasma membrane
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.969	cytosol
GO:0005856	0.878	cytoskeleton
GO:0043227	0.755	membrane-bounded organelle
GO:0043231	0.640	intracellular membrane-bounded organelle
GO:0030054	0.586	cell junction
GO:0045177	0.512	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]