StarFunc result for job id Q9H334

User Input

>input (677 residues)
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQ
ALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQV
LSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHT
AEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSH
PLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKE
RLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILE
SPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVE
FQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLAS
AIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPD
FDHDRDYEDEPVNEDME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q498D1	0.249	0.241	1.459E-91	711	0.969	0.923	Q498D1.pdb.gz	FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1
2	AFDB:Q58NQ4	0.228	0.225	1.649E-91	686	0.941	0.929	Q58NQ4.pdb.gz	FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus OX=9031 GN=FOXP1 PE=2 SV=1
3	AFDB:Q5W1J5	0.217	0.248	2.169E-74	578	0.740	0.867	Q5W1J5.pdb.gz	FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis OX=8355 GN=foxp1 PE=1 SV=1
4	AFDB:O15409	0.170	0.162	2.531E-66	715	0.685	0.649	O15409.pdb.gz	FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2 PE=1 SV=2
5	AFDB:Q4JNX5	0.253	0.248	1.680E-63	697	0.654	0.636	Q4JNX5.pdb.gz	Q4JNX5_DANRE Forkhead box P2 OS=Danio rerio OX=7955 GN=foxp2 PE=2 SV=1
6	AFDB:Q9DBY0	0.187	0.162	1.129E-55	795	0.566	0.482	Q9DBY0.pdb.gz	FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus OX=10090 GN=Foxp4 PE=1 SV=1
7	AFDB:A0A0B4K6N2	0.180	0.222	2.108E-25	520	0.244	0.317	A0A0B4K6N2.pdb.gz	A0A0B4K6N2_DROME Forkhead box P, isoform C OS=Drosophila melanogaster OX=7227 GN=FoxP PE=4 SV=1
8	AFDB:Q6U8D7	0.155	0.241	4.076E-21	431	0.207	0.325	Q6U8D7.pdb.gz	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1
9	AFDB:E3VW73	0.189	0.266	6.260E-21	443	0.235	0.359	E3VW73.pdb.gz	E3VW73_SALSA Forkhead box P3 OS=Salmo salar OX=8030 GN=foxp3 PE=2 SV=1
10	AFDB:B7ZLG1	0.158	0.232	1.156E-20	454	0.223	0.333	B7ZLG1.pdb.gz	B7ZLG1_HUMAN FOXP3 protein OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
11	PDB:2hdcA	0.105	0.591	6.990E-6	97	0.052	0.361	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.095	0.642	1.196E-1	75	0.018	0.160	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:6zmiCE	0.085	0.645	1.271E-1	72	0.016	0.153	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:3m8eA	0.080	0.395	1.727E-1	101	0.007	0.050	3m8eA.pdb.gz
15	PDB:2fe3B	0.086	0.343	1.953E-1	143	0.019	0.091	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
16	PDB:5svah	0.082	0.391	2.076E-1	118	0.013	0.076	5svah.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:1xsdA	0.090	0.417	2.207E-1	125	0.012	0.064	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
18	PDB:3euhB	0.101	0.199	2.495E-1	321	0.016	0.034	3euhB.pdb.gz
19	PDB:6qpqD	0.089	0.502	2.495E-1	82	0.012	0.098	6qpqD.pdb.gz
20	PDB:1fp1D	0.081	0.147	2.821E-1	340	0.021	0.041	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K4EPC4	0.0	588	711	0.462	0.440	K4EPC4_TAEGU Transcription factor FoxP2 (Fragment) OS=Taeniopygia guttata OX=59729 GN=foxp2 PE=2 SV=1
2	O15409	0.0	592	715	0.462	0.438	FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2 PE=1 SV=2
3	P0CF24	0.0	590	710	0.462	0.441	FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus OX=10116 GN=Foxp2 PE=3 SV=1
4	P58462	0.0	1331	705	0.970	0.932	FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus OX=10090 GN=Foxp1 PE=1 SV=1
5	P58463	0.0	591	714	0.462	0.438	FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus OX=10090 GN=Foxp2 PE=1 SV=2
6	Q498D1	0.0	1335	711	0.972	0.925	FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1
7	Q4JNX5	0.0	607	697	0.614	0.597	Q4JNX5_DANRE Forkhead box P2 OS=Danio rerio OX=7955 GN=foxp2 PE=2 SV=1
8	Q58NQ4	0.0	1054	686	0.897	0.885	FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus OX=9031 GN=FOXP1 PE=2 SV=1
9	Q5W1J5	0.0	838	578	0.709	0.830	FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis OX=8355 GN=foxp1 PE=1 SV=1
10	Q6QBA5	0.0	591	711	0.464	0.442	Q6QBA5_TAEGU Forkhead box P2 isoform I OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
11	Q6TKS2	0.0	591	709	0.464	0.443	Q6TKS2_TAEGU Forkhead box P2 OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
12	Q8IVH2	0.0	560	680	0.578	0.575	FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens OX=9606 GN=FOXP4 PE=1 SV=1
13	Q9DBY0	0.0	554	795	0.570	0.486	FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus OX=10090 GN=Foxp4 PE=1 SV=1
14	Q9H334	0.0	1387	677	1.000	1.000	FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1 PE=1 SV=1
15	Q9VH87	6.03e-93	297	442	0.220	0.337	Q9VH87_DROME Forkhead box P, isoform D OS=Drosophila melanogaster OX=7227 GN=FoxP PE=2 SV=2
16	A0A0B4K6N2	7.05e-81	268	520	0.198	0.258	A0A0B4K6N2_DROME Forkhead box P, isoform C OS=Drosophila melanogaster OX=7227 GN=FoxP PE=4 SV=1
17	Q9BZS1	7.49e-70	236	431	0.183	0.288	FOXP3_HUMAN Forkhead box protein P3 OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
18	B7ZLG1	2.11e-69	235	454	0.183	0.273	B7ZLG1_HUMAN FOXP3 protein OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
19	Q99JB6	3.25e-69	234	429	0.182	0.287	FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus OX=10090 GN=Foxp3 PE=1 SV=1
20	Q6U8D7	4.18e-69	234	431	0.179	0.281	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.1e-24	97.7	Forkhead domain
2	PF16159 FOXP-CC	4.7e-31	118.4	FOXP coiled-coil domain
3	PF18217 Zap1_zf2	4.1e+02	12.4	Zap1 zinc finger 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003234

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016316	0.857	WD repeat domain 5
2	61853.ENSNLEP00000014587	0.851	Serine/threonine-protein kinase PLK
3	61853.ENSNLEP00000007135	0.783	F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
4	61853.ENSNLEP00000013936	0.780	Forkhead box P2
5	61853.ENSNLEP00000008542	0.742	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
6	61853.ENSNLEP00000013966	0.689	Mothers against decapentaplegic homolog
7	61853.ENSNLEP00000010902	0.667	LIM homeobox 3
8	61853.ENSNLEP00000024421	0.661	Exportin 1
9	61853.ENSNLEP00000013061	0.660	ISL LIM homeobox 1
10	61853.ENSNLEP00000021453	0.654	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
11	61853.ENSNLEP00000017670	0.641	Chromodomain-helicase-DNA-binding protein 8
12	61853.ENSNLEP00000012325	0.637	Glutamate receptor, ionotropic, N-methyl D-aspartate 2A
13	61853.ENSNLEP00000009848	0.633	Forkhead box P3
14	61853.ENSNLEP00000021594	0.630	Tumor susceptibility 101
15	61853.ENSNLEP00000011484	0.613	Interleukin-2
16	61853.ENSNLEP00000019580	0.572	Gonadoliberin
17	61853.ENSNLEP00000021081	0.563	Nuclear transcription factor, X-box binding-like 1
18	61853.ENSNLEP00000022803	0.560	SRY-box 2
19	61853.ENSNLEP00000014170	0.554	Interleukin 2 receptor, alpha
20	61853.ENSNLEP00000005097	0.548	Opsin 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0001046	0.993	core promoter sequence-specific DNA binding
GO:0001221	0.991	transcription coregulator binding
GO:0042802	0.985	identical protein binding
GO:0000981	0.959	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.930	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001222	0.822	transcription corepressor binding
GO:0140297	0.808	DNA-binding transcription factor binding
GO:0000987	0.794	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.773	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.677	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001217	0.301	DNA-binding transcription repressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0050896	0.994	response to stimulus
GO:0007275	0.994	multicellular organism development
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0048518	0.977	positive regulation of biological process
GO:0048523	0.973	negative regulation of cellular process
GO:0048731	0.969	system development
GO:0048522	0.965	positive regulation of cellular process
GO:0048513	0.951	animal organ development
GO:0051239	0.915	regulation of multicellular organismal process
GO:0051171	0.907	regulation of nitrogen compound metabolic process
GO:0080090	0.905	regulation of primary metabolic process
GO:0031323	0.905	regulation of cellular metabolic process
GO:0031326	0.899	regulation of cellular biosynthetic process
GO:2001141	0.888	regulation of RNA biosynthetic process
GO:0006355	0.884	regulation of DNA-templated transcription
GO:0030154	0.880	cell differentiation
GO:0010604	0.868	positive regulation of macromolecule metabolic process
GO:0042221	0.821	response to chemical
GO:0050793	0.809	regulation of developmental process
GO:0006357	0.790	regulation of transcription by RNA polymerase II
GO:0010605	0.785	negative regulation of macromolecule metabolic process
GO:0031324	0.775	negative regulation of cellular metabolic process
GO:0051172	0.768	negative regulation of nitrogen compound metabolic process
GO:0051173	0.765	positive regulation of nitrogen compound metabolic process
GO:0031325	0.762	positive regulation of cellular metabolic process
GO:0007399	0.701	nervous system development
GO:2000026	0.689	regulation of multicellular organismal development
GO:0045595	0.650	regulation of cell differentiation
GO:0051716	0.649	cellular response to stimulus
GO:0031327	0.595	negative regulation of cellular biosynthetic process
GO:0007417	0.592	central nervous system development
GO:0071704	0.550	organic substance metabolic process
GO:0031328	0.547	positive regulation of cellular biosynthetic process
GO:0010628	0.508	positive regulation of gene expression
GO:0044238	0.493	primary metabolic process
GO:0044237	0.490	cellular metabolic process
GO:0048583	0.489	regulation of response to stimulus
GO:1902679	0.488	negative regulation of RNA biosynthetic process
GO:1903507	0.484	negative regulation of nucleic acid-templated transcription
GO:0023051	0.464	regulation of signaling
GO:0010646	0.464	regulation of cell communication
GO:0045892	0.461	negative regulation of DNA-templated transcription
GO:0043170	0.439	macromolecule metabolic process
GO:0071840	0.433	cellular component organization or biogenesis
GO:0006807	0.428	nitrogen compound metabolic process
GO:1903508	0.416	positive regulation of nucleic acid-templated transcription
GO:0045893	0.411	positive regulation of DNA-templated transcription
GO:0042127	0.399	regulation of cell population proliferation
GO:0009653	0.397	anatomical structure morphogenesis
GO:0010033	0.395	response to organic substance
GO:0016043	0.375	cellular component organization
GO:0045596	0.364	negative regulation of cell differentiation
GO:0045944	0.360	positive regulation of transcription by RNA polymerase II
GO:0000122	0.358	negative regulation of transcription by RNA polymerase II
GO:0051241	0.344	negative regulation of multicellular organismal process
GO:0044260	0.321	cellular macromolecule metabolic process
GO:0010629	0.319	negative regulation of gene expression
GO:0048468	0.305	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.969	nuclear lumen
GO:0005654	0.718	nucleoplasm
GO:0005737	0.304	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]