StarFunc result for job id Q9H361

User Input

>input (631 residues)
MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQ
HTKDAEHALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVS
AFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKERE
AELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKN
LDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPS
QIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTS
TQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQVTMQQLAVHVQGQETL
TASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRS
KVDEAVAVLQAHQAKEATQKAVNSATGVPTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9C1	0.617	0.613	0.000	636	0.927	0.920	A0A024R9C1.pdb.gz
2	AFDB:H0YAR2	0.540	0.566	8.625E-104	599	0.876	0.923	H0YAR2.pdb.gz	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
3	AFDB:Q98SP8	0.560	0.561	1.459E-93	629	0.686	0.688	Q98SP8.pdb.gz	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
4	AFDB:A3KFU5	0.645	0.645	1.550E-93	631	0.729	0.729	A3KFU5.pdb.gz	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
5	AFDB:Q62029	0.394	0.396	2.230E-93	628	0.753	0.756	Q62029.pdb.gz	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
6	AFDB:Q6PHQ9	0.709	0.680	2.369E-93	660	0.731	0.698	Q6PHQ9.pdb.gz	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
7	AFDB:Q6TGY6	0.626	0.636	1.641E-91	620	0.689	0.702	Q6TGY6.pdb.gz
8	AFDB:Q4VXU2	0.659	0.676	6.171E-87	614	0.648	0.666	Q4VXU2.pdb.gz	PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens OX=9606 GN=PABPC1L PE=2 SV=1
9	AFDB:A2A5N3	0.629	0.652	2.180E-81	607	0.583	0.606	A2A5N3.pdb.gz	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
10	AFDB:P21187	0.402	0.401	5.355E-76	634	0.550	0.547	P21187.pdb.gz	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
11	PDB:6r5kH	0.326	0.476	6.362E-37	394	0.342	0.548	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	PDB:5vsuA	0.182	0.250	1.843E-22	387	0.106	0.173	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y53o	0.149	0.470	1.928E-14	160	0.098	0.388	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.122	0.281	2.049E-14	267	0.082	0.195	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:5lsbA	0.115	0.403	2.447E-12	176	0.067	0.239	5lsbA.pdb.gz
16	PDB:7evoD	0.128	0.390	2.935E-12	200	0.070	0.220	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.121	0.403	9.255E-11	178	0.063	0.225	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.117	0.414	1.328E-9	171	0.052	0.193	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6gd1A	0.122	0.393	4.728E-8	190	0.054	0.179	6gd1A.pdb.gz
20	PDB:7dvqY	0.125	0.536	1.246E-7	140	0.044	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTT1	1030	588	0.835	0.896	A0A087WTT1_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
2	A2A5N3	695	607	0.591	0.614	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
3	A3KFU5	895	631	0.721	0.721	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
4	A3KFU8	899	644	0.716	0.702	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
5	B1ANR0	897	615	0.731	0.750	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
6	B2RXY9	694	607	0.590	0.613	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
7	E7EQV3	1097	591	0.862	0.920	E7EQV3_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
8	E7ERJ7	1111	604	0.884	0.924	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
9	F1QB54	1053	634	0.834	0.830	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1
10	H0Y5F5	702	550	0.594	0.682	H0Y5F5_HUMAN Polyadenylate-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
11	H0YAR2	1105	599	0.876	0.923	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
12	P11940	1188	636	0.929	0.921	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
13	P20965	1091	633	0.867	0.864	PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis OX=8355 GN=pabpc1-a PE=1 SV=3
14	P21187	654	634	0.567	0.565	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
15	P29341	1186	636	0.926	0.918	PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2
16	P31209	531	653	0.472	0.456	PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
17	P61286	1188	636	0.929	0.921	PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1
18	Q13310	902	644	0.734	0.719	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
19	Q19579	578	692	0.502	0.458	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
20	Q3UX16	763	590	0.621	0.664	Q3UX16_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08442 ATP-grasp_2	12	16.9	ATP-grasp domain
2	PF03880 DbpA	37	15.8	DbpA RNA binding domain
3	PF02518 HATPase_c	17	17.3	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
4	PF11608 MARF1_RRM1	0.097	24.2	MARF1, RNA recognition motif 1
5	PF14605 Nup35_RRM_2	0.0049	28.2	Nup53/35/40-type RNA recognition motif
6	PF08206 OB_RNB	20	16.3	Ribonuclease B OB domain
7	PF00658 PABP	1.9e-26	103.2	Poly-adenylate binding protein, unique domain
8	PF00076 RRM_1	1.5e-85	292.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
9	PF08777 RRM_3	0.4	22.1	RNA binding motif
10	PF13893 RRM_5	0.00024	32.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
11	PF16367 RRM_7	0.00013	33.3	RNA recognition motif
12	PF16842 RRM_occluded	0.0026	28.9	Occluded RNA-recognition motif
13	PF11767 SET_assoc	0.026	25.5	Histone lysine methyltransferase SET associated
14	PF11181 YflT	3.2	19.7	Heat induced stress protein YflT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356520	0.939	ATP-dependent RNA helicase A
2	9606.ENSP00000302768	0.930	Polyadenylate-binding protein-interacting protein 1
3	9606.ENSP00000416255	0.919	Eukaryotic translation initiation factor 4 gamma 1
4	9606.ENSP00000378917	0.870	Ataxin-2-like protein
5	9606.ENSP00000425561	0.842	Eukaryotic translation initiation factor 4E
6	9606.ENSP00000383274	0.785	Eukaryotic translation initiation factor 4 gamma 3
7	9606.ENSP00000370345	0.781	PAN2-PAN3 deadenylation complex subunit PAN3
8	9606.ENSP00000446271	0.777	Protein LSM14 homolog A
9	9606.ENSP00000244221	0.767	Polyadenylate-binding protein-interacting protein 2B
10	9606.ENSP00000336783	0.764	Trinucleotide repeat-containing gene 6C protein
11	9606.ENSP00000388806	0.755	Eukaryotic translation initiation factor 4B
12	9606.ENSP00000315791	0.745	Cleavage stimulation factor subunit 3
13	9606.ENSP00000216727	0.743	Polyadenylate-binding protein 2
14	9606.ENSP00000366843	0.743	Ataxin-2
15	9606.ENSP00000408598	0.726	Embryonic polyadenylate-binding protein 2
16	9606.ENSP00000361626	0.705	Nuclease-sensitive element-binding protein 1
17	9606.ENSP00000478754	0.687	Probable ATP-dependent RNA helicase DDX6
18	9606.ENSP00000341247	0.625	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
19	9606.ENSP00000398131	0.625	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
20	9606.ENSP00000326381	0.624	Eukaryotic initiation factor 4A-II

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003727	0.997	single-stranded RNA binding
GO:0008143	0.991	poly(A) binding
GO:0003729	0.978	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0010608	0.993	post-transcriptional regulation of gene expression
GO:1903311	0.977	regulation of mRNA metabolic process
GO:0009987	0.970	cellular process
GO:0043487	0.966	regulation of RNA stability
GO:0034248	0.943	regulation of amide metabolic process
GO:0043488	0.925	regulation of mRNA stability
GO:0031326	0.921	regulation of cellular biosynthetic process
GO:0010556	0.919	regulation of macromolecule biosynthetic process
GO:2000112	0.900	regulation of cellular macromolecule biosynthetic process
GO:0044238	0.859	primary metabolic process
GO:0071704	0.856	organic substance metabolic process
GO:0044237	0.856	cellular metabolic process
GO:0006417	0.844	regulation of translation
GO:0006807	0.841	nitrogen compound metabolic process
GO:0043170	0.806	macromolecule metabolic process
GO:0009893	0.800	positive regulation of metabolic process
GO:0010604	0.765	positive regulation of macromolecule metabolic process
GO:0048519	0.718	negative regulation of biological process
GO:0034641	0.678	cellular nitrogen compound metabolic process
GO:0009892	0.653	negative regulation of metabolic process
GO:0010605	0.567	negative regulation of macromolecule metabolic process
GO:1901360	0.544	organic cyclic compound metabolic process
GO:0046483	0.544	heterocycle metabolic process
GO:0048523	0.532	negative regulation of cellular process
GO:0031324	0.522	negative regulation of cellular metabolic process
GO:0051172	0.506	negative regulation of nitrogen compound metabolic process
GO:0048522	0.475	positive regulation of cellular process
GO:0006139	0.458	nucleobase-containing compound metabolic process
GO:0090304	0.452	nucleic acid metabolic process
GO:0016070	0.411	RNA metabolic process
GO:0010467	0.381	gene expression
GO:0010628	0.348	positive regulation of gene expression
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0031325	0.337	positive regulation of cellular metabolic process
GO:0016071	0.308	mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.839	membrane-bounded organelle
GO:0043229	0.827	intracellular organelle
GO:0043231	0.692	intracellular membrane-bounded organelle
GO:0032991	0.406	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]