StarFunc result for job id Q9H3C7

User Input

>input (697 residues)
MARLVAVCRDGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRH
GMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLVESGNPALEPLTVGPKG
VLSVTRSCMTDAKKLYTLFYVHGSKLNDMIDAIPKSKKNKRCQLHSLDTHKPKPLGGCWM
DVWELMSQECRDEVVLIDSSCLLETLETYLRKHRFCTDCKNKVLRAYNILIGELDCSKEK
GYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLT
CLGIHLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVQGISRLEQLCEEFS
EEERVRELKQEKKRQKRKNRRKNKCVCDIPTPLQTADEKEVSQEKETDFIENSSCKACGS
TEDGNTCVEVIVTNENTSCTCPSSGNLLGSPKIKKGLSPHCNGSDCGYSSSMEGSETGSR
EGSDVACTEGICNHDEHGDDSCVHHCEDKEDDGDSCVECWANSEENDTKGKNKKKKKKSK
ILKCDEHIQKLGSCITDPGNRETSGNTMHTVFHRDKTKDTHPESCCSSEKGGQPLPWFEH
RKNVPQFAEPTETLFGPDSGKGAKSLVELLDESECTSDEEIFISQDEIQSFMANNQSFYS
NREQYRQHLKEKFNKYCRLNDHKRPICSGWLTTAGAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SV77	0.719	0.720	1.432E-89	696	0.963	0.964	Q5SV77.pdb.gz	GGNB2_MOUSE Gametogenetin-binding protein 2 OS=Mus musculus OX=10090 GN=Ggnbp2 PE=1 SV=1
2	AFDB:A8MQL1	0.127	0.089	7.601E-3	1082	0.123	0.079	A8MQL1.pdb.gz	TRF1B_ARATH TNF receptor-associated factor homolog 1b OS=Arabidopsis thaliana OX=3702 GN=TRAF1B PE=1 SV=1
3	AFDB:Q54VM5	0.074	0.069	1.577E-1	771	0.128	0.115	Q54VM5.pdb.gz	Q54VM5_DICDI Protein regulator of cytokinesis 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280249 PE=3 SV=1
4	AFDB:A0A0B4KEU9	0.120	0.107	1.656E-1	804	0.110	0.096	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
5	AFDB:P13055	0.060	0.036	2.571E-1	1412	0.112	0.055	P13055.pdb.gz	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
6	AFDB:A0A0B4K822	0.106	0.073	4.856E-1	1136	0.109	0.067	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:A0A0B4JD47	0.115	0.089	5.906E-1	977	0.110	0.079	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	PDB:3wojA	0.070	0.070	7.623E-1	698	0.072	0.072	3wojA.pdb.gz	S46 peptidases are the first exopeptidases to be members of clan PA
9	PDB:7ru6A	0.060	0.102	1.073	315	0.049	0.108	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
10	AFDB:Q96PV0	0.093	0.064	1.292	1343	0.128	0.066	Q96PV0.pdb.gz	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
11	PDB:6rcuA	0.093	0.177	1.305	304	0.056	0.128	6rcuA.pdb.gz
12	PDB:5jwfA	0.087	0.087	1.512	700	0.037	0.037	5jwfA.pdb.gz
13	PDB:2w0aA	0.065	0.082	1.588	424	0.049	0.080	2w0aA.pdb.gz	Trypanosoma Cruzi Cyp51 Inhibitor Derived from a Mycobacterium Tuberculosis Screen Hit.
14	PDB:3ipmO	0.059	0.154	1.931	219	0.042	0.132	3ipmO.pdb.gz
15	AFDB:Q8TEH3	0.062	0.049	2.006	1009	0.092	0.063	Q8TEH3.pdb.gz	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
16	AFDB:Q92622	0.054	0.043	2.106	972	0.103	0.074	Q92622.pdb.gz	RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=4
17	PDB:6kkkA	0.086	0.131	2.236	381	0.056	0.102	6kkkA.pdb.gz
18	PDB:1rhgB	0.069	0.223	2.465	144	0.034	0.167	1rhgB.pdb.gz
19	PDB:3godA	0.077	0.126	2.589	320	0.046	0.100	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
20	PDB:1t72A	0.058	0.143	2.855	215	0.042	0.135	1t72A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SV77	0.0	1397	696	0.963	0.964	GGNB2_MOUSE Gametogenetin-binding protein 2 OS=Mus musculus OX=10090 GN=Ggnbp2 PE=1 SV=1
2	Q5PQY9	0.11	37.7	318	0.055	0.119	Q5PQY9_DANRE Muscle-related coiled-coil protein OS=Danio rerio OX=7955 GN=murc PE=1 SV=1
3	A0A2X0TW08	2.3	33.9	790	0.034	0.030	A0A2X0TW08_HUMAN PLEKHG6 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=4 SV=1
4	Q3KR16	2.3	33.9	790	0.034	0.030	PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3
5	Q9W0R7	2.5	33.9	576	0.027	0.033	Q9W0R7_DROME Ada2a-containing complex component 3, isoform B OS=Drosophila melanogaster OX=7227 GN=Atac3 PE=4 SV=3
6	Q93XQ4	7.0	32.3	371	0.037	0.070	PMT2_NICAT Putrescine N-methyltransferase 2 OS=Nicotiana attenuata OX=49451 GN=PMT2 PE=2 SV=1
7	Q9W554	8.7	32.3	1052	0.022	0.014	Q9W554_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Gcna PE=1 SV=1
8	Q7KW09	9.2	32.0	1030	0.022	0.015	GCNA_DROME Germ cell nuclear acidic protein OS=Drosophila melanogaster OX=7227 GN=Gcna PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334940	0.835	Gametogenetin
2	9606.ENSP00000363745	0.686	Heterogeneous nuclear ribonucleoprotein R
3	9606.ENSP00000484687	0.665	Zinc finger HIT-type containing 3
4	9606.ENSP00000478886	0.616	Uncharacterized protein C17orf78
5	9606.ENSP00000259874	0.609	Radiation-inducible immediate-early gene IEX-1
6	9606.ENSP00000479518	0.603	Unconventional myosin-XIX
7	9606.ENSP00000483453	0.600	Synergin gamma
8	9606.ENSP00000479504	0.596	Probable ATP-dependent RNA helicase DDX52
9	9606.ENSP00000481091	0.595	Transcriptional adapter 2-alpha
10	9606.ENSP00000481559	0.589	rRNA methyltransferase 1, mitochondrial
11	9606.ENSP00000482202	0.574	Phosphatidylinositol-glycan biosynthesis class W protein
12	9606.ENSP00000482704	0.571	Dehydrogenase/reductase SDR family member 11
13	9606.ENSP00000477848	0.540	Protein AATF
14	9606.ENSP00000313922	0.531	Ornithine decarboxylase antizyme 3
15	9606.ENSP00000394888	0.521	Dedicator of cytokinesis protein 8
16	9606.ENSP00000339155	0.520	Cysteine-rich secretory protein 2
17	9606.ENSP00000477653	0.510	Dual specificity protein phosphatase 14
18	9606.ENSP00000237654	0.500	Cyclin-I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.983	biological regulation
GO:0009987	0.983	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0080090	0.926	regulation of primary metabolic process
GO:0051171	0.918	regulation of nitrogen compound metabolic process
GO:0031323	0.914	regulation of cellular metabolic process
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0048523	0.883	negative regulation of cellular process
GO:0050790	0.845	regulation of catalytic activity
GO:0032502	0.844	developmental process
GO:0032501	0.825	multicellular organismal process
GO:0010468	0.823	regulation of gene expression
GO:0009966	0.822	regulation of signal transduction
GO:0031324	0.815	negative regulation of cellular metabolic process
GO:0051248	0.729	negative regulation of protein metabolic process
GO:0009968	0.706	negative regulation of signal transduction
GO:0045936	0.701	negative regulation of phosphate metabolic process
GO:0042326	0.686	negative regulation of phosphorylation
GO:0001890	0.684	placenta development
GO:1904892	0.684	regulation of receptor signaling pathway via STAT
GO:0050730	0.684	regulation of peptidyl-tyrosine phosphorylation
GO:0051338	0.618	regulation of transferase activity
GO:1904893	0.565	negative regulation of receptor signaling pathway via STAT
GO:0042509	0.565	regulation of tyrosine phosphorylation of STAT protein
GO:0001933	0.564	negative regulation of protein phosphorylation
GO:0001701	0.562	in utero embryonic development
GO:0046425	0.528	regulation of receptor signaling pathway via JAK-STAT
GO:0001892	0.528	embryonic placenta development
GO:0050732	0.528	negative regulation of peptidyl-tyrosine phosphorylation
GO:0060711	0.501	labyrinthine layer development
GO:0046426	0.501	negative regulation of receptor signaling pathway via JAK-STAT
GO:0043549	0.478	regulation of kinase activity
GO:0033135	0.415	regulation of peptidyl-serine phosphorylation
GO:0045859	0.413	regulation of protein kinase activity
GO:0044092	0.334	negative regulation of molecular function
GO:0008152	0.328	metabolic process
GO:0071704	0.320	organic substance metabolic process
GO:0043086	0.314	negative regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031974	0.775	membrane-enclosed lumen
GO:0070013	0.715	intracellular organelle lumen
GO:0005829	0.687	cytosol
GO:0031981	0.435	nuclear lumen
GO:0005654	0.403	nucleoplasm
GO:0043232	0.369	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]