StarFunc result for job id Q9H3D4

User Input

>input (680 residues)
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4N5	0.352	0.352	0.000	680	1.000	1.000	A0A0S2Z4N5.pdb.gz	A0A0S2Z4N5_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
2	AFDB:E9QG65	0.564	0.602	1.651E-81	632	0.685	0.737	E9QG65.pdb.gz
3	AFDB:B0S576	0.409	0.430	5.907E-68	640	0.532	0.566	B0S576.pdb.gz	B0S576_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
4	AFDB:D4AA88	0.400	0.398	2.419E-66	684	0.525	0.522	D4AA88.pdb.gz	D4AA88_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
5	AFDB:A0A0R4IHL8	0.338	0.431	3.091E-62	527	0.513	0.662	A0A0R4IHL8.pdb.gz
6	AFDB:P25035	0.308	0.524	9.926E-42	396	0.271	0.465	P25035.pdb.gz	P53_ONCMY Cellular tumor antigen p53 OS=Oncorhynchus mykiss OX=8022 GN=tp53 PE=2 SV=1
7	AFDB:Q9TUB2	0.345	0.601	1.375E-39	386	0.240	0.422	Q9TUB2.pdb.gz	P53_PIG Cellular tumor antigen p53 OS=Sus scrofa OX=9823 GN=TP53 PE=2 SV=1
8	AFDB:G1K2L5	0.308	0.556	6.582E-39	374	0.234	0.425	G1K2L5.pdb.gz	G1K2L5_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=brp53 PE=1 SV=1
9	AFDB:P10361	0.295	0.507	1.246E-38	391	0.241	0.419	P10361.pdb.gz	P53_RAT Cellular tumor antigen p53 OS=Rattus norvegicus OX=10116 GN=Tp53 PE=1 SV=1
10	AFDB:P10360	0.300	0.549	2.100E-38	367	0.235	0.436	P10360.pdb.gz	P53_CHICK Cellular tumor antigen p53 OS=Gallus gallus OX=9031 GN=TP53 PE=1 SV=1
11	PDB:6xreM	0.226	0.439	3.159E-20	314	0.194	0.420	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
12	PDB:6drvA	0.113	0.078	5.082E-3	1024	0.018	0.012	6drvA.pdb.gz
13	PDB:4n20A	0.115	0.120	1.213E-2	639	0.041	0.044	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
14	PDB:4f38B	0.132	0.380	1.363E-2	192	0.037	0.130	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
15	PDB:1q90A	0.117	0.217	1.444E-2	292	0.019	0.045	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
16	PDB:7u05B	0.098	0.084	1.444E-2	815	0.019	0.016	7u05B.pdb.gz
17	PDB:7d56C	0.119	0.125	1.718E-2	640	0.026	0.028	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
18	PDB:8dypA	0.105	0.191	2.896E-2	326	0.019	0.040	8dypA.pdb.gz
19	PDB:7zxyC	0.108	0.221	3.253E-2	279	0.013	0.032	7zxyC.pdb.gz	Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
20	PDB:3oaiA	0.103	0.139	3.447E-2	488	0.015	0.020	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4N5	0.0	1420	680	1.000	1.000	A0A0S2Z4N5_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
2	A0A0S2Z4N6	0.0	1406	676	0.993	0.999	A0A0S2Z4N6_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
3	A0A8I6ADJ7	0.0	530	452	0.419	0.631	A0A8I6ADJ7_RAT Cellular tumor antigen p53 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
4	A0A8I6APF4	0.0	647	590	0.506	0.583	A0A8I6APF4_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
5	B0S576	0.0	669	640	0.541	0.575	B0S576_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
6	B0S577	0.0	547	555	0.465	0.569	B0S577_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
7	C9D7D0	0.0	817	416	0.579	0.947	C9D7D0_HUMAN Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
8	D4AA88	0.0	656	684	0.524	0.520	D4AA88_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
9	F1NWD0	0.0	1165	586	0.821	0.952	F1NWD0_CHICK Tumor protein 63 (p63) OS=Gallus gallus OX=9031 GN=TP63 PE=2 SV=2
10	O15350	0.0	662	636	0.535	0.572	P73_HUMAN Tumor protein p73 OS=Homo sapiens OX=9606 GN=TP73 PE=1 SV=1
11	O88898	0.0	1397	680	0.979	0.979	P63_MOUSE Tumor protein 63 OS=Mus musculus OX=10090 GN=Tp63 PE=1 SV=1
12	Q801Z7	0.0	668	640	0.540	0.573	Q801Z7_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=sb:eu652 PE=2 SV=1
13	Q8JFE3	0.0	876	576	0.650	0.767	Q8JFE3_DANRE Tumor protein 63 (p63) (Fragment) OS=Danio rerio OX=7955 GN=wu:fc89f04 PE=1 SV=1
14	Q8JHZ5	0.0	670	457	0.504	0.751	Q8JHZ5_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=tp73l PE=1 SV=1
15	Q8JHZ6	0.0	869	588	0.647	0.748	Q8JHZ6_DANRE Tumor protein 63 (p63) OS=Danio rerio OX=7955 GN=fc89f04 PE=1 SV=1
16	Q9DEC7	0.0	1102	582	0.806	0.942	Q9DEC7_CHICK Tumor protein 63 (p63) OS=Gallus gallus OX=9031 GN=dNp63a PE=2 SV=1
17	Q9H3D4	0.0	1420	680	1.000	1.000	P63_HUMAN Tumor protein 63 OS=Homo sapiens OX=9606 GN=TP63 PE=1 SV=1
18	Q9JJP2	0.0	657	631	0.521	0.561	P73_MOUSE Tumor protein p73 OS=Mus musculus OX=10090 GN=Tp73 PE=1 SV=1
19	Q9JJP6	0.0	1396	680	0.978	0.978	P63_RAT Tumor protein 63 OS=Rattus norvegicus OX=10116 GN=Tp63 PE=2 SV=1
20	A0A8I5ZJF2	1.12e-163	481	494	0.343	0.472	A0A8I5ZJF2_RAT Cellular tumor antigen p53 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00870 P53	9.3e-61	216.6	P53 DNA-binding domain
2	PF07710 P53_tetramer	8.9e-16	68.3	P53 tetramerisation motif
3	PF07647 SAM_2	6.9e-07	40.6	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264731

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.996	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000480499	0.989	E3 ubiquitin-protein ligase Itchy homolog
3	9606.ENSP00000263253	0.983	Histone acetyltransferase p300
4	9606.ENSP00000397157	0.963	P53 apoptosis effector related to PMP-22
5	9606.ENSP00000418915	0.962	Cyclin-dependent kinase inhibitor 2A
6	9606.ENSP00000426909	0.957	Receptor of activated protein C kinase 1
7	9606.ENSP00000427793	0.956	NEDD4-like E3 ubiquitin-protein ligase WWP1
8	9606.ENSP00000269305	0.955	Cellular tumor antigen p53
9	9606.ENSP00000281708	0.953	F-box/WD repeat-containing protein 7
10	9606.ENSP00000340989	0.950	14-3-3 protein sigma
11	9606.ENSP00000365530	0.941	Syntaxin-binding protein 4
12	9606.ENSP00000256925	0.938	CDK5 and ABL1 enzyme substrate 1
13	9606.ENSP00000430684	0.932	Inhibitor of nuclear factor kappa-B kinase subunit beta
14	9606.ENSP00000359206	0.930	F-box/WD repeat-containing protein 1A
15	9606.ENSP00000347979	0.928	Tumor necrosis factor receptor superfamily member 6
16	9606.ENSP00000361423	0.928	Tyrosine-protein kinase ABL1
17	9606.ENSP00000307305	0.927	DNA damage-inducible transcript 4 protein
18	9606.ENSP00000268058	0.926	Protein PML
19	9606.ENSP00000300093	0.923	Serine/threonine-protein kinase PLK1
20	9606.ENSP00000367545	0.919	Tumor protein p73

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0140110	0.998	transcription regulator activity
GO:0005515	0.953	protein binding
GO:0003700	0.941	DNA-binding transcription factor activity
GO:0043565	0.834	sequence-specific DNA binding
GO:0003690	0.325	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048523	0.993	negative regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048522	0.977	positive regulation of cellular process
GO:0010468	0.968	regulation of gene expression
GO:0050896	0.964	response to stimulus
GO:0080090	0.959	regulation of primary metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0008219	0.931	cell death
GO:0019219	0.926	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.919	cellular response to stimulus
GO:0048856	0.916	anatomical structure development
GO:0006355	0.915	regulation of DNA-templated transcription
GO:0032501	0.912	multicellular organismal process
GO:0006950	0.838	response to stress
GO:0042127	0.837	regulation of cell population proliferation
GO:0048583	0.836	regulation of response to stimulus
GO:0031324	0.785	negative regulation of cellular metabolic process
GO:0009893	0.778	positive regulation of metabolic process
GO:0010605	0.756	negative regulation of macromolecule metabolic process
GO:0010604	0.756	positive regulation of macromolecule metabolic process
GO:0009890	0.756	negative regulation of biosynthetic process
GO:0051172	0.754	negative regulation of nitrogen compound metabolic process
GO:0006915	0.712	apoptotic process
GO:0033554	0.709	cellular response to stress
GO:0007165	0.697	signal transduction
GO:0010558	0.692	negative regulation of macromolecule biosynthetic process
GO:0045934	0.683	negative regulation of nucleobase-containing compound metabolic process
GO:0009966	0.656	regulation of signal transduction
GO:1903507	0.655	negative regulation of nucleic acid-templated transcription
GO:0045892	0.654	negative regulation of DNA-templated transcription
GO:0051173	0.637	positive regulation of nitrogen compound metabolic process
GO:0035556	0.633	intracellular signal transduction
GO:0000003	0.607	reproduction
GO:0008152	0.564	metabolic process
GO:0097193	0.505	intrinsic apoptotic signaling pathway
GO:0016043	0.495	cellular component organization
GO:0031325	0.484	positive regulation of cellular metabolic process
GO:0044237	0.478	cellular metabolic process
GO:0006807	0.467	nitrogen compound metabolic process
GO:0071704	0.458	organic substance metabolic process
GO:0044238	0.451	primary metabolic process
GO:0045935	0.436	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.431	regulation of transcription by RNA polymerase II
GO:0048584	0.381	positive regulation of response to stimulus
GO:0009653	0.377	anatomical structure morphogenesis
GO:0043170	0.374	macromolecule metabolic process
GO:0031328	0.355	positive regulation of cellular biosynthetic process
GO:0010941	0.326	regulation of cell death
GO:0045893	0.326	positive regulation of DNA-templated transcription
GO:0051246	0.325	regulation of protein metabolic process
GO:0042981	0.318	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.849	cytoplasm
GO:0005829	0.377	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]