StarFunc result for job id Q9H3E2

User Input

>input (840 residues)
MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVC
NDVVRTLLTHFCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKD
VQSLSLRIMLAEILTTKVLKPVVELLSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSY
EDFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNM
KRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGPQSQKILQFEDILANTFYREH
FGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQ
QCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMG
PRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLK
DEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVG
GVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNK
FLQNLLSDERLCQSEALYAFLSPSPDYLKVIDVQGKKNSFSLSSFLERLPRDFFSHQEEE
TEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINK
QIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIP
DMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C0S0	0.488	0.411	3.426E-97	1004	1.000	0.837	A0A494C0S0.pdb.gz	A0A494C0S0_HUMAN Sorting nexin 25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=1
2	AFDB:Q3ZT31	0.566	0.566	2.832E-89	840	0.873	0.873	Q3ZT31.pdb.gz	SNX25_MOUSE Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3
3	AFDB:Q8T4E8	0.443	0.339	6.144E-48	1117	0.338	0.254	Q8T4E8.pdb.gz	Q8T4E8_DROME AT01932p OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=1
4	AFDB:F1QM62	0.339	0.300	2.809E-26	955	0.242	0.213	F1QM62.pdb.gz	F1QM62_DANRE Sorting nexin 13 OS=Danio rerio OX=7955 GN=snx13 PE=3 SV=3
5	AFDB:Q9USN1	0.314	0.265	5.458E-26	1010	0.199	0.165	Q9USN1.pdb.gz	SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx12 PE=3 SV=1
6	AFDB:Q9Y5W8	0.336	0.294	1.061E-25	968	0.238	0.207	Q9Y5W8.pdb.gz	SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4
7	AFDB:Q01846	0.339	0.256	5.067E-22	1127	0.195	0.146	Q01846.pdb.gz	MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM1 PE=1 SV=3
8	AFDB:Q5PNP1	0.303	0.275	2.559E-21	934	0.193	0.173	Q5PNP1.pdb.gz	SNX14_DANRE Sorting nexin-14 OS=Danio rerio OX=7955 GN=snx14 PE=2 SV=3
9	AFDB:Q8BHY8	0.307	0.271	2.312E-20	964	0.185	0.161	Q8BHY8.pdb.gz	SNX14_MOUSE Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2
10	AFDB:Q92543	0.340	0.290	2.146E-16	992	0.200	0.169	Q92543.pdb.gz	SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2
11	PDB:4pzgA	0.123	0.575	2.040E-3	152	0.036	0.197	4pzgA.pdb.gz
12	PDB:1ocuA	0.112	0.597	9.481E-3	134	0.029	0.179	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
13	PDB:2dybA	0.110	0.282	1.030E-2	298	0.037	0.104	2dybA.pdb.gz
14	PDB:2mxcA	0.109	0.465	1.167E-2	172	0.030	0.145	2mxcA.pdb.gz
15	PDB:1agrE	0.130	0.777	1.696E-2	128	0.027	0.180	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
16	PDB:7shfC	0.134	0.272	2.087E-2	400	0.061	0.128	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
17	PDB:6q0xA	0.106	0.224	1.145E-1	373	0.069	0.155	6q0xA.pdb.gz
18	PDB:3c4wB	0.125	0.196	2.048E-1	519	0.020	0.033	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:7jpxA	0.065	0.055	2.320E-1	1116	0.125	0.094	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
20	PDB:3gb8A	0.065	0.060	3.819E-1	958	0.098	0.086	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0S0	0.0	1741	1004	1.000	0.837	A0A494C0S0_HUMAN Sorting nexin 25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=1
2	Q3ZT31	0.0	1499	840	0.873	0.873	SNX25_MOUSE Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3
3	Q9H3E2	0.0	1739	840	1.000	1.000	SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=2
4	Q9W3N0	1.54e-153	480	1117	0.352	0.265	Q9W3N0_DROME FI21262p1 OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=2
5	Q8T4E8	2.38e-153	480	1117	0.352	0.265	Q8T4E8_DROME AT01932p OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=1
6	Q9Y5W8	1.14e-48	188	968	0.270	0.235	SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4
7	F1QM62	2.91e-43	172	955	0.261	0.229	F1QM62_DANRE Sorting nexin 13 OS=Danio rerio OX=7955 GN=snx13 PE=3 SV=3
8	Q9USN1	1.21e-17	90.5	1010	0.215	0.179	SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx12 PE=3 SV=1
9	Q9Y5W7	1.32e-15	84.0	946	0.149	0.132	SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=3
10	Q8BHY8	1.91e-13	77.0	964	0.111	0.096	SNX14_MOUSE Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2
11	D6RJG9	3.27e-11	69.7	935	0.140	0.126	D6RJG9_HUMAN Sorting nexin 14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=2
12	Q5PNP1	3.12e-10	66.6	934	0.051	0.046	SNX14_DANRE Sorting nexin-14 OS=Danio rerio OX=7955 GN=snx14 PE=2 SV=3
13	Q6P4T1	1.74e-09	63.9	997	0.045	0.038	SNX19_MOUSE Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1
14	Q92543	1.87e-08	60.8	992	0.038	0.032	SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2
15	Q01846	5.80e-07	55.8	1127	0.090	0.067	MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM1 PE=1 SV=3
16	P49802	1.06e-06	54.7	495	0.046	0.079	RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3
17	P49803	1.07e-06	54.7	477	0.046	0.082	RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus OX=10116 GN=Rgs7 PE=1 SV=2
18	O54829	1.38e-06	54.3	469	0.046	0.083	RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus OX=10090 GN=Rgs7 PE=1 SV=2
19	Q9Z2H1	2.22e-06	53.5	443	0.038	0.072	RGS11_MOUSE Regulator of G-protein signaling 11 OS=Mus musculus OX=10090 GN=Rgs11 PE=1 SV=2
20	O94810	8.34e-06	51.6	467	0.038	0.069	RGS11_HUMAN Regulator of G-protein signaling 11 OS=Homo sapiens OX=9606 GN=RGS11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06246 Isy1	3.3e+02	12.2	Isy1-like splicing family
2	PF08628 Nexin_C	1.1e-24	98.4	Sorting nexin C terminal
3	PF00787 PX	3.1e-12	58.4	PX domain
4	PF02194 PXA	3e-22	91.0	PXA domain
5	PF00615 RGS	8.1e-18	76.2	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385347	0.732	Transmembrane anterior posterior transformation protein 1 homolog
2	9606.ENSP00000357836	0.679	Sorting nexin-27
3	9606.ENSP00000219334	0.668	Sphingomyelin phosphodiesterase 3
4	9606.ENSP00000418593	0.647	Sorting nexin-21
5	9606.ENSP00000314173	0.632	Sterile alpha motif domain containing 12
6	9606.ENSP00000233575	0.609	Sorting nexin-17
7	9606.ENSP00000267339	0.608	Ankyrin repeat domain-containing protein 10
8	9606.ENSP00000303356	0.608	L-xylulose reductase
9	9606.ENSP00000386653	0.607	Protocadherin 20
10	9606.ENSP00000387250	0.607	Protocadherin-20
11	9606.ENSP00000406490	0.599	PMS1 protein homolog 1
12	9606.ENSP00000262753	0.586	Protein POF1B
13	9606.ENSP00000264431	0.584	Rap guanine nucleotide exchange factor 2
14	9606.ENSP00000439128	0.556	Barrier-to-autointegration factor-like protein
15	9606.ENSP00000366452	0.540	Sorting nexin-15
16	9606.ENSP00000368831	0.539	Sorting nexin-2
17	9606.ENSP00000302537	0.536	Nuclear protein MDM1
18	9606.ENSP00000387209	0.523	Centrosomal protein of 19 kDa
19	9606.ENSP00000261889	0.519	Sorting nexin-1
20	9606.ENSP00000235329	0.506	Mitofusin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	0.995	cytokine receptor binding
GO:0005160	0.994	transforming growth factor beta receptor binding
GO:0034713	0.879	type I transforming growth factor beta receptor binding
GO:0005543	0.811	phospholipid binding
GO:0035091	0.795	phosphatidylinositol binding
GO:1901981	0.405	phosphatidylinositol phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.985	regulation of biological process
GO:0030512	0.981	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0009057	0.974	macromolecule catabolic process
GO:0019222	0.964	regulation of metabolic process
GO:0043112	0.938	receptor metabolic process
GO:0044248	0.880	cellular catabolic process
GO:0031323	0.861	regulation of cellular metabolic process
GO:0051246	0.861	regulation of protein metabolic process
GO:0042325	0.773	regulation of phosphorylation
GO:0001932	0.735	regulation of protein phosphorylation
GO:0060393	0.710	regulation of pathway-restricted SMAD protein phosphorylation
GO:0010563	0.300	negative regulation of phosphorus metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.936	cytoplasm
GO:0012505	0.846	endomembrane system
GO:0005829	0.739	cytosol
GO:0016020	0.729	membrane
GO:0031982	0.567	vesicle
GO:0005768	0.452	endosome
GO:0070013	0.335	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]