StarFunc result for job id Q9H3J6

User Input

>input (166 residues)
MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENEL
EEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFY
NGENSPVHKEKREAAKKKQERKKRAKETLEKKKLLKELWESSKKVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H3J6	1.000	1.000	1.609E-27	166	1.000	1.000	Q9H3J6.pdb.gz	MTRFR_HUMAN Mitochondrial translation release factor in rescue OS=Homo sapiens OX=9606 GN=MTRFR PE=1 SV=1
2	PDB:7a5hC	0.655	0.942	2.805E-14	114	0.681	0.991	7a5hC.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
3	AFDB:Q9Y811	0.613	0.628	5.717E-10	162	0.331	0.340	Q9Y811.pdb.gz	YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.18c PE=3 SV=2
4	AFDB:Q05863	0.425	0.450	2.414E-7	155	0.247	0.265	Q05863.pdb.gz	YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR281C PE=1 SV=1
5	AFDB:Q57WY8	0.418	0.157	6.056E-7	459	0.199	0.072	Q57WY8.pdb.gz	Q57WY8_TRYB2 Peptide chain release factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.190 PE=3 SV=1
6	AFDB:O51214	0.405	0.191	5.655E-6	357	0.163	0.076	O51214.pdb.gz	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
7	AFDB:Q9LVY0	0.417	0.155	6.450E-6	456	0.163	0.059	Q9LVY0.pdb.gz	PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB1 PE=2 SV=1
8	PDB:7nqhBL	0.407	0.274	6.887E-6	250	0.145	0.096	7nqhBL.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
9	AFDB:P9WHG1	0.418	0.189	8.389E-6	371	0.157	0.070	P9WHG1.pdb.gz	RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prfB PE=1 SV=1
10	AFDB:Q8K126	0.415	0.158	9.567E-6	446	0.139	0.052	Q8K126.pdb.gz	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
11	AFDB:O75570	0.401	0.153	1.165E-5	445	0.169	0.063	O75570.pdb.gz	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
12	AFDB:P07012	0.396	0.186	1.244E-5	365	0.157	0.071	P07012.pdb.gz	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
13	PDB:6c4iv	0.373	0.178	1.845E-5	362	0.163	0.075	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
14	PDB:6gxnv	0.397	0.197	8.933E-5	348	0.133	0.063	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
15	PDB:7jss8	0.339	0.418	8.884E-3	132	0.163	0.205	7jss8.pdb.gz	ArfB can displace mRNA to rescue stalled ribosomes.
16	PDB:2b3tB	0.331	0.191	9.488E-3	300	0.127	0.070	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
17	PDB:7qi4A1	0.278	0.177	1.010E-1	279	0.114	0.068	7qi4A1.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
18	PDB:6xywBz	0.253	0.325	1.079E-1	123	0.096	0.130	6xywBz.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:2qzvA	0.159	0.053	2.082E-1	749	0.127	0.028	2qzvA.pdb.gz
20	PDB:7rx9A	0.192	0.083	2.374E-1	432	0.048	0.019	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H3J6	2.76e-121	340	166	1.000	1.000	MTRFR_HUMAN Mitochondrial translation release factor in rescue OS=Homo sapiens OX=9606 GN=MTRFR PE=1 SV=1
2	Q9Y811	4.69e-19	80.9	162	0.259	0.265	YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.18c PE=3 SV=2
3	Q05863	1.22e-12	63.9	155	0.193	0.206	YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR281C PE=1 SV=1
4	Q57WY8	2.56e-12	65.9	459	0.199	0.072	Q57WY8_TRYB2 Peptide chain release factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.190 PE=3 SV=1
5	P9WHG1	2.32e-09	57.0	371	0.157	0.070	RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prfB PE=1 SV=1
6	O51214	1.01e-08	55.5	357	0.181	0.084	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
7	O75570	4.61e-08	53.5	445	0.151	0.056	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
8	Q8K126	3.13e-07	51.2	446	0.139	0.052	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
9	Q09691	1.17e-06	49.3	396	0.151	0.063	RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F7.17 PE=3 SV=1
10	Q9LVY0	1.85e-06	48.9	456	0.169	0.061	PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB1 PE=2 SV=1
11	Q8BJU9	2.75e-06	48.1	373	0.163	0.072	RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1l PE=2 SV=1
12	Q9HTA0	4.39e-06	47.0	204	0.187	0.152	Q9HTA0_PSEAE Probable peptide chain release factor OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5470 PE=3 SV=1
13	P07012	8.13e-06	47.0	365	0.145	0.066	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
14	P30775	1.19e-05	46.6	413	0.139	0.056	RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRF1 PE=1 SV=1
15	Q9UGC7	3.08e-05	45.1	380	0.157	0.068	RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1L PE=1 SV=1
16	P0A7I0	3.17e-05	45.1	360	0.133	0.061	RF1_ECOLI Peptide chain release factor RF1 OS=Escherichia coli (strain K12) OX=83333 GN=prfA PE=1 SV=1
17	Q9C875	4.51e-05	44.3	257	0.277	0.179	Q9C875_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=T16O9.18 PE=1 SV=1
18	Q8RX79	0.001	40.4	422	0.120	0.047	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
19	P40711	0.43	32.3	140	0.133	0.157	ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB OS=Escherichia coli (strain K12) OX=83333 GN=arfB PE=1 SV=2
20	M9PHD8	3.6	30.4	1714	0.102	0.010	M9PHD8_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00472 RF-1	2.1e-19	81.0	RF-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301585	0.966	Peptidyl-tRNA hydrolase ICT1, mitochondrial
2	9606.ENSP00000362036	0.822	Mitochondrial ribosomal protein S16
3	9606.ENSP00000359680	0.820	4-hydroxy-2-oxoglutarate aldolase, mitochondrial
4	9606.ENSP00000356202	0.793	Peptide chain release factor 1-like, mitochondrial
5	9606.ENSP00000343867	0.754	Ribosome-recycling factor, mitochondrial
6	9606.ENSP00000288937	0.716	Mitochondrial ribosomal protein L17
7	9606.ENSP00000258455	0.713	Mitochondrial ribosomal protein S9
8	9606.ENSP00000258975	0.698	Translational activator of cytochrome c oxidase 1
9	9606.ENSP00000296805	0.689	Ribosome-releasing factor 2, mitochondrial
10	9606.ENSP00000341082	0.685	Mitochondrial ribosomal protein L20
11	9606.ENSP00000357823	0.681	Mitochondrial ribosomal protein L9
12	9606.ENSP00000290846	0.671	Mitochondrial tRNA-specific 2-thiouridylase 1
13	9606.ENSP00000313877	0.657	Elongation factor Ts, mitochondrial
14	9606.ENSP00000367590	0.657	Receptor expression-enhancing protein 2
15	9606.ENSP00000352510	0.656	Tectonin beta-propeller repeat-containing protein 2
16	9606.ENSP00000316335	0.653	Phenylalanine--tRNA ligase, mitochondrial
17	9606.ENSP00000220058	0.644	Methionyl-tRNA formyltransferase, mitochondrial
18	9606.ENSP00000410964	0.637	Erlin-1
19	9606.ENSP00000225969	0.635	Mitochondrial ribosomal protein L27
20	9606.ENSP00000382250	0.634	Mitochondrial ribosomal protein S6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043023	1.000	ribosomal large subunit binding
GO:0000049	1.000	tRNA binding
GO:0003824	0.384	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006414	0.995	translational elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.962	intracellular organelle lumen
GO:0016020	0.958	membrane
GO:0032991	0.921	protein-containing complex
GO:0043232	0.838	intracellular non-membrane-bounded organelle
GO:0031981	0.584	nuclear lumen
GO:0005654	0.460	nucleoplasm
GO:1990904	0.433	ribonucleoprotein complex
GO:0005740	0.315	mitochondrial envelope
GO:0031966	0.314	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]