StarFunc result for job id Q9H3K2

User Input

>input (345 residues)
MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQ
ELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYV
KDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSI
PYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEK
FLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIK
RAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91VC9	0.813	0.811	2.702E-35	346	0.893	0.890	Q91VC9.pdb.gz	GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus OX=10090 GN=Ghitm PE=1 SV=1
2	AFDB:Q9VIB2	0.770	0.730	8.512E-24	365	0.452	0.427	Q9VIB2.pdb.gz	Q9VIB2_DROME MIP04261p OS=Drosophila melanogaster OX=7227 GN=Mics1 PE=2 SV=2
3	AFDB:Q9LD45	0.542	0.743	3.139E-7	247	0.145	0.202	Q9LD45.pdb.gz	BI1_ARATH Bax inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=BI-1 PE=1 SV=1
4	AFDB:P55061	0.552	0.783	1.017E-6	237	0.154	0.224	P55061.pdb.gz	BI1_HUMAN Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 PE=1 SV=2
5	AFDB:P0AAC4	0.565	0.813	1.724E-5	234	0.125	0.184	P0AAC4.pdb.gz	YBHL_ECOLI Inner membrane protein YbhL OS=Escherichia coli (strain K12) OX=83333 GN=ybhL PE=1 SV=1
6	AFDB:Q8BJZ3	0.357	0.397	3.461E-5	309	0.125	0.139	Q8BJZ3.pdb.gz	LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus OX=10090 GN=Tmbim1 PE=1 SV=1
7	AFDB:A0A0R4IG88	0.506	0.483	5.588E-5	363	0.122	0.116	A0A0R4IG88.pdb.gz
8	AFDB:Q7Z429	0.522	0.489	5.588E-5	371	0.130	0.121	Q7Z429.pdb.gz	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
9	AFDB:A0A024R472	0.428	0.470	7.256E-5	311	0.145	0.161	A0A024R472.pdb.gz
10	AFDB:Q9ESF4	0.517	0.517	1.074E-4	345	0.142	0.142	Q9ESF4.pdb.gz	LFG1_MOUSE Protein lifeguard 1 OS=Mus musculus OX=10090 GN=Grina PE=2 SV=1
11	PDB:7o3vF	0.139	0.164	2.328E-1	261	0.110	0.146	7o3vF.pdb.gz
12	PDB:7z0sD	0.127	0.137	3.758E-1	306	0.119	0.134	7z0sD.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
13	PDB:7p54A	0.141	0.128	3.925E-1	397	0.122	0.106	7p54A.pdb.gz
14	PDB:7y47B	0.226	0.126	3.925E-1	767	0.081	0.037	7y47B.pdb.gz	Structural and mechanistic insights into the precise product synthesis by a bifunctional miltiradiene synthase.
15	PDB:7p5cA	0.140	0.125	5.097E-1	392	0.139	0.122	7p5cA.pdb.gz
16	PDB:6ibbA	0.148	0.163	5.324E-1	301	0.107	0.123	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
17	PDB:5b63C	0.135	0.098	6.067E-1	553	0.090	0.056	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
18	PDB:7uraA	0.162	0.141	7.879E-1	432	0.113	0.090	7uraA.pdb.gz	Mechanisms and inhibition of Porcupine-mediated Wnt acylation.
19	PDB:6x15A	0.116	0.103	8.596E-1	419	0.128	0.105	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
20	PDB:7f04C	0.142	0.185	8.596E-1	231	0.093	0.139	7f04C.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91VC9	0.0	627	346	0.919	0.916	GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus OX=10090 GN=Ghitm PE=1 SV=1
2	Q9H3K2	0.0	698	345	1.000	1.000	GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2
3	Q9VIB2	4.90e-98	296	365	0.441	0.416	Q9VIB2_DROME MIP04261p OS=Drosophila melanogaster OX=7227 GN=Mics1 PE=2 SV=2
4	P55062	1.66e-06	50.8	237	0.104	0.152	BI1_RAT Bax inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Tmbim6 PE=2 SV=2
5	Q9D2C7	3.52e-05	47.0	237	0.099	0.143	BI1_MOUSE Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6 PE=1 SV=1
6	P55061	0.008	39.7	237	0.061	0.089	BI1_HUMAN Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 PE=1 SV=2
7	Q9DA39	0.015	38.9	238	0.113	0.164	LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tmbim4 PE=2 SV=1
8	Q9LD45	0.015	38.9	247	0.046	0.065	BI1_ARATH Bax inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=BI-1 PE=1 SV=1
9	O74888	0.021	38.5	266	0.099	0.128	BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bxi1 PE=3 SV=1
10	Q9VFM3	0.024	38.5	264	0.116	0.152	Q9VFM3_DROME IP10175p OS=Drosophila melanogaster OX=7227 GN=Recs1 PE=2 SV=1
11	Q9VSH3	0.061	37.0	245	0.162	0.229	BI1_DROME Bax inhibitor 1 OS=Drosophila melanogaster OX=7227 GN=BI-1 PE=2 SV=1
12	Q9ZQX7	0.068	37.0	248	0.067	0.093	LFG3_ARATH Protein LIFEGUARD 3 OS=Arabidopsis thaliana OX=3702 GN=LFG3 PE=2 SV=1
13	Q9ZUC2	0.16	35.8	258	0.110	0.147	BCA3_ARATH Beta carbonic anhydrase 3 OS=Arabidopsis thaliana OX=3702 GN=BCA3 PE=2 SV=1
14	Q969X1	0.57	34.3	311	0.064	0.071	LFG3_HUMAN Protein lifeguard 3 OS=Homo sapiens OX=9606 GN=TMBIM1 PE=1 SV=2
15	Q5SUA5	0.58	34.7	1024	0.055	0.019	MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus OX=10090 GN=Myo1g PE=1 SV=1
16	Q1MW40	0.59	34.3	311	0.064	0.071	Q1MW40_HUMAN Responsive to centrifugal force and shear stress gene 1 OS=Homo sapiens OX=9606 GN=RECS1 PE=2 SV=1
17	F4JIE8	0.92	33.5	235	0.087	0.128	LFG1_ARATH Protein LIFEGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=LFG1 PE=2 SV=1
18	P0AAC4	1.3	32.7	234	0.113	0.167	YBHL_ECOLI Inner membrane protein YbhL OS=Escherichia coli (strain K12) OX=83333 GN=ybhL PE=1 SV=1
19	Q8BJZ3	1.3	33.1	309	0.058	0.065	LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus OX=10090 GN=Tmbim1 PE=1 SV=1
20	Q9Y216	1.3	33.5	660	0.041	0.021	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01027 Bax1-I	9.1e-38	141.7	Inhibitor of apoptosis-promoting Bax1
2	PF14145 YrhK	3.7e+02	12.4	YrhK-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363089	0.969	Toll-like receptor 4
2	9606.ENSP00000315477	0.898	CD209 antigen
3	9606.ENSP00000284818	0.886	Lymphocyte antigen 96
4	9606.ENSP00000277632	0.842	Ubiquitin carboxyl-terminal hydrolase MINDY-3
5	9606.ENSP00000438115	0.804	COP9 signalosome complex subunit 7a
6	9606.ENSP00000259467	0.759	Phosducin-like protein
7	9606.ENSP00000319009	0.754	Transmembrane protein 45A
8	9606.ENSP00000378812	0.749	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
9	9606.ENSP00000389160	0.744	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
10	9606.ENSP00000356301	0.683	Transmembrane protein 9
11	9606.ENSP00000365924	0.651	E3 ubiquitin-protein ligase TRIM31
12	9606.ENSP00000346067	0.618	40S ribosomal protein SA
13	9606.ENSP00000417240	0.608	Ribosomal protein SA pseudogene 58
14	9606.ENSP00000418428	0.605	Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
15	9606.ENSP00000375855	0.595	Phosducin
16	9606.ENSP00000380553	0.591	Tetraspanin-4
17	9606.ENSP00000379869	0.589	Elongator complex protein 5
18	9606.ENSP00000409738	0.571	Protein lifeguard 3
19	9606.ENSP00000273258	0.556	PRA1 family protein 3
20	9606.ENSP00000404860	0.552	Schwannomin interacting protein 1, isoform CRA_c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.956	regulation of response to stimulus
GO:0009966	0.947	regulation of signal transduction
GO:0048523	0.941	negative regulation of cellular process
GO:2001234	0.897	negative regulation of apoptotic signaling pathway
GO:0016043	0.886	cellular component organization
GO:0010821	0.883	regulation of mitochondrion organization
GO:0010639	0.866	negative regulation of organelle organization
GO:0061024	0.794	membrane organization
GO:0090199	0.743	regulation of release of cytochrome c from mitochondria
GO:0010823	0.743	negative regulation of mitochondrion organization
GO:0006996	0.715	organelle organization
GO:0007006	0.684	mitochondrial membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.991	membrane
GO:0005576	0.975	extracellular region
GO:0031090	0.972	organelle membrane
GO:0031982	0.938	vesicle
GO:0005615	0.909	extracellular space
GO:0043230	0.785	extracellular organelle
GO:1903561	0.765	extracellular vesicle
GO:0070062	0.722	extracellular exosome
GO:0031966	0.583	mitochondrial membrane
GO:0019866	0.510	organelle inner membrane
GO:0005743	0.475	mitochondrial inner membrane
GO:0032991	0.316	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]