StarFunc result for job id Q9H3L0

User Input

>input (296 residues)
MANVLCNRARLVSYLPGFCSLVKRVVNPKAFSTAGSSGSDESHVAAAPPDICSRTVWPDE
TMGPFGPQDQRFQLPGNIGFDCHLNGTASQKKSLVHKTLPDVLAEPLSSERHEFVMAQYV
NEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQ
KTKNDMTVWSEEVEIEREVLLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTNN
TLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIFTNATPDSHIMKKLSGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H3L0	1.000	1.000	1.147E-60	296	1.000	1.000	Q9H3L0.pdb.gz	MMAD_HUMAN Cobalamin trafficking protein CblD OS=Homo sapiens OX=9606 GN=MMADHC PE=1 SV=2
2	AFDB:Q9W375	0.358	0.371	2.111E-8	284	0.193	0.201	Q9W375.pdb.gz	Q9W375_DROME LP04941p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG12118 PE=2 SV=1
3	AFDB:P31170	0.126	0.149	1.576E-2	227	0.159	0.207	P31170.pdb.gz	HS25P_ARATH Heat shock protein 21, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP21 PE=1 SV=1
4	PDB:5ujcA	0.243	0.265	8.596E-2	267	0.095	0.105	5ujcA.pdb.gz	Coordination chemistry controls the thiol oxidase activity of the B12-trafficking protein CblC.
5	AFDB:A1ZAX8	0.133	0.065	1.221E-1	858	0.115	0.040	A1ZAX8.pdb.gz	A1ZAX8_DROME Hermansky-Pudlak syndrome 4, isoform A OS=Drosophila melanogaster OX=7227 GN=HPS4 PE=1 SV=1
6	AFDB:Q653A4	0.124	0.100	1.221E-1	396	0.095	0.071	Q653A4.pdb.gz	Q653A4_ORYSJ Basic helix-loop-helix-like OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0526100 PE=3 SV=1
7	AFDB:A8QW55	0.117	0.104	2.005E-1	348	0.145	0.124	A8QW55.pdb.gz	A8QW55_VAUFR Aureochrome1 OS=Vaucheria frigida OX=195983 GN=AUREO1 PE=1 SV=1
8	AFDB:Q62052	0.090	0.041	3.504E-1	833	0.125	0.044	Q62052.pdb.gz	P_MOUSE P protein OS=Mus musculus OX=10090 GN=Oca2 PE=1 SV=1
9	PDB:2fn0B	0.149	0.117	3.810E-1	412	0.054	0.039	2fn0B.pdb.gz	Crystal Structures of Yersinia enterocolitica Salicylate Synthase and its Complex with the Reaction Products Salicylate and Pyruvate.
10	AFDB:Q586U1	0.102	0.057	4.221E-1	715	0.142	0.059	Q586U1.pdb.gz	Q586U1_TRYB2 Transcription initiation protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.65 PE=3 SV=1
11	AFDB:Q5DT39	0.107	0.109	4.491E-1	243	0.078	0.095	Q5DT39.pdb.gz	KLRI1_RAT Killer cell lectin-like receptor subfamily I member 1 OS=Rattus norvegicus OX=10116 GN=Klri1 PE=1 SV=1
12	AFDB:Q0WNR2	0.132	0.096	6.125E-1	441	0.108	0.073	Q0WNR2.pdb.gz	BH090_ARATH Transcription factor bHLH90 OS=Arabidopsis thaliana OX=3702 GN=BHLH90 PE=1 SV=1
13	PDB:3somN	0.206	0.251	6.258E-1	232	0.047	0.060	3somN.pdb.gz	Structure of MMACHC reveals an arginine-rich pocket and a domain-swapped dimer for its B12 processing function.
14	PDB:1k8kD	0.181	0.187	8.533E-1	284	0.044	0.046	1k8kD.pdb.gz
15	PDB:5i08A	0.098	0.041	9.660E-1	958	0.057	0.018	5i08A.pdb.gz
16	PDB:5ko7B	0.158	0.215	1.028	200	0.078	0.115	5ko7B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
17	PDB:5ko8B	0.152	0.196	1.028	218	0.071	0.096	5ko8B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
18	PDB:4ztuB	0.166	0.145	1.094	363	0.044	0.036	4ztuB.pdb.gz	Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
19	PDB:1lmiA	0.107	0.197	1.238	131	0.051	0.115	1lmiA.pdb.gz
20	PDB:4jdlB	0.088	0.136	1.317	154	0.057	0.110	4jdlB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H3L0	0.0	621	296	1.000	1.000	MMAD_HUMAN Cobalamin trafficking protein CblD OS=Homo sapiens OX=9606 GN=MMADHC PE=1 SV=2
2	Q9W375	1.59e-13	71.6	284	0.155	0.162	Q9W375_DROME LP04941p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG12118 PE=2 SV=1
3	Q22886	3.3	32.0	615	0.084	0.041	Q22886_CAEEL EB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=B0507.1 PE=1 SV=2
4	Q584N8	4.2	31.6	829	0.054	0.019	Q584N8_TRYB2 Retrotransposon hot spot (RHS) protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=3B10.5 PE=4 SV=1
5	P86353	5.6	30.8	239	0.044	0.054	LECB_SPAPA Seed lectin beta chain OS=Spatholobus parviflorus OX=132465 PE=1 SV=1
6	P86352	6.1	30.4	251	0.044	0.052	LECA_SPAPA Seed lectin alpha chain OS=Spatholobus parviflorus OX=132465 PE=1 SV=1
7	P08638	7.5	30.8	886	0.081	0.027	LEUR_YEAST Regulatory protein LEU3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEU3 PE=1 SV=1
8	O09046	9.9	30.4	630	0.091	0.043	OXLA_MOUSE L-amino-acid oxidase OS=Mus musculus OX=10090 GN=Il4i1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10229 MMADHC	9.6e-131	447.0	Methylmalonic aciduria and homocystinuria type D protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383840	0.992	Methylmalonic aciduria and homocystinuria type C protein
2	9606.ENSP00000355536	0.965	Methionine synthase
3	9606.ENSP00000264668	0.960	Methionine synthase reductase
4	9606.ENSP00000359609	0.955	Probable lysosomal cobalamin transporter
5	9606.ENSP00000445920	0.944	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
6	9606.ENSP00000281317	0.941	Methylmalonic aciduria type A protein, mitochondrial
7	9606.ENSP00000274813	0.919	Methylmalonyl-CoA mutase, mitochondrial
8	9606.ENSP00000244217	0.854	Methylmalonyl-CoA epimerase, mitochondrial
9	9606.ENSP00000349396	0.791	ATP-binding cassette sub-family D member 4
10	9606.ENSP00000479130	0.729	Acyl-CoA synthetase family member 3, mitochondrial
11	9606.ENSP00000262225	0.704	Transmembrane emp24 domain-containing protein 2
12	9606.ENSP00000360644	0.688	Dolichol-phosphate mannosyltransferase subunit 1
13	9606.ENSP00000358737	0.684	ATP synthase F(0) complex subunit B1, mitochondrial
14	9606.ENSP00000418695	0.681	Proteasome 26S subunit, non-ATPase 6
15	9606.ENSP00000481878	0.672	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
16	9606.ENSP00000318480	0.667	ATP-dependent zinc metalloprotease YME1L1
17	9606.ENSP00000350512	0.666	COP9 signalosome complex subunit 5
18	9606.ENSP00000264033	0.662	E3 ubiquitin-protein ligase CBL
19	9606.ENSP00000365462	0.659	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
20	9606.ENSP00000301458	0.654	CD320 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0044281	0.975	small molecule metabolic process
GO:0006767	0.948	water-soluble vitamin metabolic process
GO:0006725	0.938	cellular aromatic compound metabolic process
GO:1901360	0.932	organic cyclic compound metabolic process
GO:0033013	0.911	tetrapyrrole metabolic process
GO:0065007	0.427	biological regulation
GO:0009235	0.334	cobalamin metabolic process
GO:0044238	0.305	primary metabolic process
GO:0050789	0.302	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005739	0.999	mitochondrion
GO:0043233	0.579	organelle lumen
GO:0070013	0.567	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]