StarFunc result for job id Q9H3M7

User Input

>input (391 residues)
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BG60	0.780	0.768	6.914E-63	397	0.959	0.945	Q8BG60.pdb.gz	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
2	AFDB:A0A024RC80	0.711	0.666	3.784E-40	418	0.450	0.421	A0A024RC80.pdb.gz
3	AFDB:A0A0B4J1F4	0.707	0.667	1.404E-39	415	0.448	0.422	A0A0B4J1F4.pdb.gz	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
4	AFDB:Q8TBH0	0.721	0.693	5.411E-36	407	0.394	0.378	Q8TBH0.pdb.gz	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
5	AFDB:Q7TPQ9	0.702	0.664	1.236E-35	414	0.419	0.396	Q7TPQ9.pdb.gz	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
6	AFDB:Q0E8K8	0.716	0.813	1.033E-26	342	0.184	0.211	Q0E8K8.pdb.gz	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
7	AFDB:O45782	0.646	0.597	6.868E-26	426	0.215	0.197	O45782.pdb.gz	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
8	AFDB:Q8N5I2	0.647	0.588	3.123E-23	433	0.223	0.201	Q8N5I2.pdb.gz	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
9	AFDB:Q20577	0.664	0.743	1.628E-22	346	0.171	0.194	Q20577.pdb.gz	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
10	AFDB:Q8SYU5	0.627	0.533	3.718E-22	469	0.199	0.166	Q8SYU5.pdb.gz	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
11	PDB:5f0jB	0.544	0.676	5.037E-15	306	0.105	0.134	5f0jB.pdb.gz
12	PDB:2r51A	0.535	0.698	1.869E-14	288	0.097	0.132	2r51A.pdb.gz
13	PDB:2wtrB	0.490	0.518	1.105E-12	367	0.128	0.136	2wtrB.pdb.gz
14	PDB:5tv1A	0.484	0.552	3.546E-12	337	0.115	0.134	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
15	PDB:3gc3A	0.450	0.524	1.012E-10	329	0.123	0.146	3gc3A.pdb.gz
16	PDB:5w0pC	0.492	0.245	1.012E-10	850	0.133	0.061	5w0pC.pdb.gz
17	PDB:7jsmB	0.455	0.463	3.755E-10	383	0.107	0.110	7jsmB.pdb.gz
18	PDB:3gd1E	0.424	0.532	5.322E-8	300	0.141	0.183	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
19	PDB:1f13A	0.216	0.131	9.345E-7	722	0.066	0.036	1f13A.pdb.gz
20	PDB:5mhlA	0.185	0.117	1.135E-6	692	0.069	0.039	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5M7W1	0.0	789	394	0.967	0.959	TXNIP_RAT Thioredoxin-interacting protein OS=Rattus norvegicus OX=10116 GN=Txnip PE=2 SV=1
2	Q8BG60	0.0	781	397	0.959	0.945	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
3	Q9H3M7	0.0	810	391	1.000	1.000	TXNIP_HUMAN Thioredoxin-interacting protein OS=Homo sapiens OX=9606 GN=TXNIP PE=1 SV=1
4	Q8NCT1	5.14e-113	338	418	0.458	0.428	ARRD4_HUMAN Arrestin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ARRDC4 PE=1 SV=3
5	A0A0B4J1F4	1.40e-107	324	415	0.442	0.417	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
6	Q96B67	3.36e-103	313	414	0.427	0.403	ARRD3_HUMAN Arrestin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARRDC3 PE=1 SV=1
7	Q7TPQ9	1.97e-99	303	414	0.427	0.403	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
8	Q8TBH0	1.17e-85	268	407	0.391	0.376	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
9	O45782	1.98e-24	106	426	0.212	0.195	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
10	Q0E8K8	6.00e-19	89.4	342	0.199	0.228	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
11	Q8SYE1	6.47e-19	89.4	342	0.199	0.228	Q8SYE1_DROME RE65532p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
12	Q8N5I2	9.92e-17	83.6	433	0.182	0.164	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
13	Q9XXI4	6.15e-15	78.2	419	0.235	0.220	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
14	Q20577	1.71e-14	76.3	346	0.179	0.202	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
15	Q8SYW4	1.27e-12	69.7	271	0.148	0.214	Q8SYW4_DROME RE30730p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
16	Q8SYU5	4.74e-08	57.0	469	0.130	0.109	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
17	Q9VGU4	2.22e-07	55.1	520	0.118	0.088	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2
18	Q09889	4.23e-07	54.3	594	0.141	0.093	YC9F_SCHPO Arrestin domain-containing protein C584.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC584.15c PE=1 SV=1
19	Q09729	4.21e-04	44.7	596	0.128	0.084	YA4C_SCHPO Arrestin domain-containing protein C31A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC31A2.12 PE=1 SV=1
20	Q55CH0	4.45e-04	44.7	654	0.161	0.096	ADCC_DICDI Arrestin domain-containing protein C OS=Dictyostelium discoideum OX=44689 GN=adcC PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02752 Arrestin_C	1.4e-12	59.7	Arrestin (or S-antigen), C-terminal domain
2	PF00339 Arrestin_N	2.4e-20	84.6	Arrestin (or S-antigen), N-terminal domain
3	PF03643 Vps26	2.9e+02	11.8	Vacuolar protein sorting-associated protein 26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462521

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363641	0.999	Thioredoxin
2	9606.ENSP00000337383	0.998	NACHT, LRR and PYD domains-containing protein 3
3	9606.ENSP00000307305	0.990	DNA damage-inducible transcript 4 protein
4	9606.ENSP00000340944	0.977	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000360916	0.976	Guanine nucleotide exchange factor VAV2
6	9606.ENSP00000480499	0.976	E3 ubiquitin-protein ligase Itchy homolog
7	9606.ENSP00000216185	0.964	Thioredoxin, mitochondrial
8	9606.ENSP00000263253	0.923	Histone acetyltransferase p300
9	9606.ENSP00000363377	0.923	Forkhead box protein O4
10	9606.ENSP00000350512	0.920	COP9 signalosome complex subunit 5
11	9606.ENSP00000351908	0.899	Mitogen-activated protein kinase kinase kinase 5
12	9606.ENSP00000438483	0.893	Importin subunit alpha-1
13	9606.ENSP00000256474	0.888	Von Hippel-Lindau disease tumor suppressor
14	9606.ENSP00000362649	0.886	Histone deacetylase 1
15	9606.ENSP00000383199	0.796	E3 ubiquitin-protein ligase NEDD4-like
16	9606.ENSP00000427793	0.770	NEDD4-like E3 ubiquitin-protein ligase WWP1
17	9606.ENSP00000433138	0.762	Caspase-1
18	9606.ENSP00000360609	0.750	Heat shock protein HSP 90-beta
19	9606.ENSP00000269305	0.748	Cellular tumor antigen p53
20	9606.ENSP00000320886	0.742	Carbohydrate-responsive element-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.891	enzyme binding
GO:0044389	0.767	ubiquitin-like protein ligase binding
GO:0031625	0.695	ubiquitin protein ligase binding
GO:0098772	0.675	molecular function regulator activity
GO:0030234	0.595	enzyme regulator activity
GO:0140678	0.568	molecular function inhibitor activity
GO:0004857	0.560	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0048519	0.968	negative regulation of biological process
GO:0006950	0.963	response to stress
GO:0048523	0.958	negative regulation of cellular process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0048518	0.897	positive regulation of biological process
GO:0048522	0.868	positive regulation of cellular process
GO:0042221	0.858	response to chemical
GO:0032502	0.845	developmental process
GO:0080090	0.834	regulation of primary metabolic process
GO:0051171	0.826	regulation of nitrogen compound metabolic process
GO:0007154	0.822	cell communication
GO:0031323	0.822	regulation of cellular metabolic process
GO:0010033	0.816	response to organic substance
GO:0009607	0.813	response to biotic stimulus
GO:1901700	0.813	response to oxygen-containing compound
GO:0048856	0.800	anatomical structure development
GO:0043588	0.772	skin development
GO:0007165	0.766	signal transduction
GO:0006979	0.754	response to oxidative stress
GO:0051179	0.749	localization
GO:0009605	0.719	response to external stimulus
GO:0051302	0.718	regulation of cell division
GO:0008152	0.715	metabolic process
GO:0009893	0.713	positive regulation of metabolic process
GO:0010468	0.711	regulation of gene expression
GO:0010604	0.686	positive regulation of macromolecule metabolic process
GO:0009719	0.669	response to endogenous stimulus
GO:0009888	0.643	tissue development
GO:0030154	0.628	cell differentiation
GO:0009889	0.623	regulation of biosynthetic process
GO:0007166	0.621	cell surface receptor signaling pathway
GO:0071704	0.615	organic substance metabolic process
GO:0019219	0.615	regulation of nucleobase-containing compound metabolic process
GO:0008544	0.613	epidermis development
GO:0044238	0.607	primary metabolic process
GO:0009892	0.605	negative regulation of metabolic process
GO:0031326	0.599	regulation of cellular biosynthetic process
GO:0030216	0.549	keratinocyte differentiation
GO:0014070	0.523	response to organic cyclic compound
GO:0010556	0.506	regulation of macromolecule biosynthetic process
GO:1903506	0.496	regulation of nucleic acid-templated transcription
GO:0010941	0.491	regulation of cell death
GO:0006807	0.485	nitrogen compound metabolic process
GO:0006810	0.485	transport
GO:0006355	0.483	regulation of DNA-templated transcription
GO:0010605	0.457	negative regulation of macromolecule metabolic process
GO:0051782	0.453	negative regulation of cell division
GO:0070887	0.452	cellular response to chemical stimulus
GO:0007169	0.424	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051173	0.418	positive regulation of nitrogen compound metabolic process
GO:0051641	0.413	cellular localization
GO:0048583	0.393	regulation of response to stimulus
GO:0033993	0.393	response to lipid
GO:0043170	0.376	macromolecule metabolic process
GO:0032501	0.365	multicellular organismal process
GO:0031325	0.357	positive regulation of cellular metabolic process
GO:0051172	0.339	negative regulation of nitrogen compound metabolic process
GO:0006357	0.336	regulation of transcription by RNA polymerase II
GO:0009966	0.326	regulation of signal transduction
GO:0009628	0.322	response to abiotic stimulus
GO:0065009	0.321	regulation of molecular function
GO:1901564	0.320	organonitrogen compound metabolic process
GO:0051246	0.320	regulation of protein metabolic process
GO:0042127	0.319	regulation of cell population proliferation
GO:0019538	0.308	protein metabolic process
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.973	cytosol
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005634	0.929	nucleus
GO:0031981	0.923	nuclear lumen
GO:0005654	0.646	nucleoplasm
GO:0016020	0.353	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]