StarFunc result for job id Q9H3P2

User Input

>input (528 residues)
MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGT
LHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDI
LGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQ
KSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTP
IPPSRTLLRKERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDY
AAGLVSTQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPEEPS
APSPTLPAQFKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQTPPVAMVAPQTQ
APAQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQI
KLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFX9	0.398	0.391	3.497E-77	539	1.000	0.980	A0A0C4DFX9.pdb.gz	A0A0C4DFX9_HUMAN Negative elongation factor complex member A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
2	AFDB:H0Y3X6	0.313	0.311	1.323E-61	532	0.867	0.861	H0Y3X6.pdb.gz	H0Y3X6_HUMAN Negative elongation factor complex member A (Fragment) OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
3	PDB:6gmlU	0.332	0.923	2.079E-25	183	0.343	0.989	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
4	AFDB:Q86NP2	0.369	0.161	1.453E-20	1251	0.314	0.133	Q86NP2.pdb.gz	NELFA_DROME Negative elongation factor A OS=Drosophila melanogaster OX=7227 GN=Nelf-A PE=1 SV=2
5	AFDB:Q9DFH1	0.067	0.083	1.302E-2	407	0.091	0.118	Q9DFH1.pdb.gz	Q9DFH1_DANRE HMG box transcription factor Sox9b OS=Danio rerio OX=7955 GN=fb18d01 PE=2 SV=1
6	AFDB:Q9CSP9	0.115	0.089	2.151E-2	761	0.114	0.079	Q9CSP9.pdb.gz	TTC14_MOUSE Tetratricopeptide repeat protein 14 OS=Mus musculus OX=10090 GN=Ttc14 PE=1 SV=3
7	AFDB:M0QZI3	0.056	0.036	2.275E-2	896	0.169	0.099	M0QZI3.pdb.gz
8	AFDB:P08553	0.072	0.050	3.974E-2	848	0.114	0.071	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
9	AFDB:P33981	0.093	0.066	1.213E-1	857	0.159	0.098	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2
10	AFDB:Q12124	0.067	0.075	1.282E-1	431	0.076	0.093	Q12124.pdb.gz	MED2_YEAST Mediator of RNA polymerase II transcription subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED2 PE=1 SV=1
11	AFDB:Q69Z61	0.072	0.059	1.282E-1	730	0.104	0.075	Q69Z61.pdb.gz	PWP2A_MOUSE PWWP domain-containing protein 2A OS=Mus musculus OX=10090 GN=Pwwp2a PE=2 SV=2
12	PDB:5zx3C	0.083	0.043	2.374E-1	1105	0.019	0.009	5zx3C.pdb.gz	Structural basis for transcription initiation by bacterial ECF sigma factors.
13	PDB:5mrcEE	0.082	0.144	2.806E-1	288	0.019	0.035	5mrcEE.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:4v6xAC	0.079	0.170	6.128E-1	226	0.015	0.035	4v6xAC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:4by6E	0.069	0.132	8.100E-1	168	0.017	0.054	4by6E.pdb.gz	Structure and RNA-Binding Properties of the not1-not2-not5 Module of the Yeast Ccr4-not Complex
16	PDB:6jcyC	0.080	0.041	8.100E-1	1139	0.017	0.008	6jcyC.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
17	PDB:4v6wAC	0.078	0.165	9.575E-1	227	0.013	0.031	4v6wAC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:3j7aG	0.077	0.162	1.012	224	0.011	0.027	3j7aG.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
19	PDB:7l08AD	0.076	0.113	1.012	343	0.023	0.035	7l08AD.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:7pnvD	0.076	0.113	1.012	343	0.011	0.017	7pnvD.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFX9	0.0	1070	539	1.000	0.980	A0A0C4DFX9_HUMAN Negative elongation factor complex member A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
2	A0A8I5Y6E2	0.0	810	496	0.845	0.899	A0A8I5Y6E2_RAT Negative elongation factor complex member A OS=Rattus norvegicus OX=10116 GN=Nelfa PE=1 SV=1
3	C9JHL4	0.0	561	283	0.527	0.982	C9JHL4_HUMAN Negative elongation factor complex member A (Fragment) OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=2
4	F7FPZ3	0.0	920	521	0.941	0.954	F7FPZ3_RAT Negative elongation factor complex member A OS=Rattus norvegicus OX=10116 GN=Nelfa PE=1 SV=1
5	H0Y3X6	0.0	921	532	0.867	0.861	H0Y3X6_HUMAN Negative elongation factor complex member A (Fragment) OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
6	Q5U2N1	0.0	946	530	0.958	0.955	Q5U2N1_RAT Wolf-Hirschhorn syndrome candidate 2 (Human) OS=Rattus norvegicus OX=10116 GN=Nelfa PE=1 SV=1
7	Q8BG30	0.0	919	530	0.958	0.955	NELFA_MOUSE Negative elongation factor A OS=Mus musculus OX=10090 GN=Nelfa PE=1 SV=1
8	Q9H3P2	0.0	1069	528	1.000	1.000	NELFA_HUMAN Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3
9	C9JEM7	2.46e-147	422	208	0.394	1.000	C9JEM7_HUMAN Negative elongation factor complex member A (Fragment) OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
10	H7C0W2	1.24e-106	318	187	0.305	0.861	H7C0W2_HUMAN Negative elongation factor complex member A (Fragment) OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
11	Q86NP2	1.69e-69	244	1251	0.256	0.108	NELFA_DROME Negative elongation factor A OS=Drosophila melanogaster OX=7227 GN=Nelf-A PE=1 SV=2
12	M9PC48	0.026	40.0	18095	0.057	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PCJ6	0.031	39.7	18641	0.057	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC41	0.17	37.4	22743	0.057	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	A0A0A6YYJ5	0.24	37.0	1668	0.087	0.028	A0A0A6YYJ5_HUMAN Microtubule actin crosslinking factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=2
16	Q9VT65	5.3	32.3	925	0.083	0.048	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08773 CathepsinC_exc	3.1e+02	13.0	Cathepsin C exclusion domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339495	0.999	Negative elongation factor B
2	9606.ENSP00000364578	0.999	Negative elongation factor E
3	9606.ENSP00000473290	0.999	Negative elongation factor C/D
4	9606.ENSP00000470252	0.994	Transcription elongation factor SPT5
5	9606.ENSP00000225504	0.985	Transcription elongation factor SPT4
6	9606.ENSP00000480158	0.976	DNA-directed RNA polymerase II subunit RPB1
7	9606.ENSP00000219252	0.970	DNA-directed RNA polymerase II subunit RPB3
8	9606.ENSP00000370625	0.957	DNA-directed RNA polymerase II subunit RPB2
9	9606.ENSP00000301788	0.922	DNA-directed RNA polymerase II subunit RPB7
10	9606.ENSP00000221859	0.920	DNA-directed RNA polymerase II subunit RPB9
11	9606.ENSP00000292614	0.920	DNA-directed RNA polymerase II subunit RPB11-a
12	9606.ENSP00000272645	0.918	DNA-directed RNA polymerase II subunit RPB4
13	9606.ENSP00000324124	0.918	DNA-directed RNA polymerases I, II, and III subunit RPABC5
14	9606.ENSP00000342889	0.917	DNA-directed RNA polymerases I, II, and III subunit RPABC4
15	9606.ENSP00000478303	0.917	DNA-directed RNA polymerases I, II, and III subunit RPABC1
16	9606.ENSP00000403852	0.916	DNA-directed RNA polymerases I, II, and III subunit RPABC2
17	9606.ENSP00000364289	0.909	Nuclear cap-binding protein subunit 1
18	9606.ENSP00000326806	0.829	Nuclear cap-binding protein subunit 2
19	9606.ENSP00000305653	0.827	Mitochondrial proton/calcium exchanger protein
20	9606.ENSP00000415203	0.763	GPI ethanolamine phosphate transferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0005515	0.999	protein binding
GO:0060090	0.922	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0031323	0.939	regulation of cellular metabolic process
GO:0051173	0.918	positive regulation of nitrogen compound metabolic process
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:0031325	0.906	positive regulation of cellular metabolic process
GO:0010468	0.875	regulation of gene expression
GO:0034243	0.871	regulation of transcription elongation by RNA polymerase II
GO:0031399	0.843	regulation of protein modification process
GO:0031056	0.822	regulation of histone modification
GO:0048523	0.795	negative regulation of cellular process
GO:0031060	0.733	regulation of histone methylation
GO:0010558	0.696	negative regulation of macromolecule biosynthetic process
GO:0051172	0.693	negative regulation of nitrogen compound metabolic process
GO:0031324	0.693	negative regulation of cellular metabolic process
GO:0051254	0.687	positive regulation of RNA metabolic process
GO:0006357	0.662	regulation of transcription by RNA polymerase II
GO:0045934	0.653	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.641	negative regulation of RNA metabolic process
GO:0031058	0.639	positive regulation of histone modification
GO:0031328	0.633	positive regulation of cellular biosynthetic process
GO:0010557	0.625	positive regulation of macromolecule biosynthetic process
GO:0045892	0.625	negative regulation of DNA-templated transcription
GO:0031062	0.622	positive regulation of histone methylation
GO:1902680	0.577	positive regulation of RNA biosynthetic process
GO:0045893	0.490	positive regulation of DNA-templated transcription
GO:0045944	0.364	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0032991	0.955	protein-containing complex
GO:0016604	0.940	nuclear body
GO:0140513	0.889	nuclear protein-containing complex
GO:0008023	0.615	transcription elongation factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]