StarFunc result for job id Q9H3Q1

User Input

>input (356 residues)
MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEP
DGESLDEQPSSSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLP
QLNEKEAAEKGTSKLPKSLSSSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLD
EQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIMDKEEWDPEEGEGGYH
GDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHALEDEGWAAAAPSPGSARSMG
SHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEEEDEIRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2R6D8	0.358	0.358	4.430E-47	356	1.000	1.000	B2R6D8.pdb.gz	B2R6D8_HUMAN CDC42 effector protein (Rho GTPase binding) 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=2 SV=1
2	AFDB:Q9JM96	0.334	0.338	2.239E-38	349	0.787	0.802	Q9JM96.pdb.gz	BORG4_MOUSE Cdc42 effector protein 4 OS=Mus musculus OX=10090 GN=Cdc42ep4 PE=1 SV=1
3	AFDB:Q3UHC7	0.079	0.032	4.893E-1	1189	0.171	0.051	Q3UHC7.pdb.gz	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
4	AFDB:Q54DW7	0.091	0.040	1.191	986	0.135	0.049	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
5	AFDB:P24588	0.076	0.065	1.676	427	0.160	0.133	P24588.pdb.gz	AKAP5_HUMAN A-kinase anchor protein 5 OS=Homo sapiens OX=9606 GN=AKAP5 PE=1 SV=3
6	AFDB:A8JUV7	0.078	0.037	2.705	1105	0.154	0.050	A8JUV7.pdb.gz	A8JUV7_DROME Brother of ihog, isoform G OS=Drosophila melanogaster OX=7227 GN=boi PE=1 SV=3
7	AFDB:O75626	0.077	0.040	2.897	825	0.160	0.069	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
8	AFDB:Q9SZW3	0.059	0.024	3.322	1311	0.174	0.047	Q9SZW3.pdb.gz	Q9SZW3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30100 PE=1 SV=1
9	AFDB:P40795	0.076	0.045	4.078	730	0.132	0.064	P40795.pdb.gz	FOG_DROME Protein folded gastrulation OS=Drosophila melanogaster OX=7227 GN=fog PE=2 SV=1
10	AFDB:Q9LTJ8	0.088	0.049	4.367	746	0.160	0.076	Q9LTJ8.pdb.gz	MBD13_ARATH Methyl-CpG-binding domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=MBD13 PE=2 SV=1
11	PDB:6rqhD	0.058	0.187	5.913	70	0.028	0.143	6rqhD.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
12	PDB:7w59R	0.068	0.081	6.779	280	0.051	0.064	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:2w1tA	0.032	0.065	8.324	175	0.011	0.023	2w1tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2R6D8	0.0	712	356	1.000	1.000	B2R6D8_HUMAN CDC42 effector protein (Rho GTPase binding) 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=2 SV=1
2	Q9H3Q1	0.0	712	356	1.000	1.000	BORG4_HUMAN Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
3	Q9JM96	3.45e-174	489	349	0.792	0.808	BORG4_MOUSE Cdc42 effector protein 4 OS=Mus musculus OX=10090 GN=Cdc42ep4 PE=1 SV=1
4	J3KRZ9	1.40e-84	253	127	0.357	1.000	J3KRZ9_HUMAN CDC42 effector protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
5	Q91W92	4.55e-23	101	409	0.228	0.198	BORG5_MOUSE Cdc42 effector protein 1 OS=Mus musculus OX=10090 GN=Cdc42ep1 PE=1 SV=1
6	Q00587	1.44e-21	97.1	391	0.230	0.210	BORG5_HUMAN Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1
7	Q6NZY7	1.04e-12	67.0	148	0.096	0.230	BORG3_HUMAN Cdc42 effector protein 5 OS=Homo sapiens OX=9606 GN=CDC42EP5 PE=2 SV=1
8	Q9Z0X0	4.75e-12	65.5	150	0.093	0.220	BORG3_MOUSE Cdc42 effector protein 5 OS=Mus musculus OX=10090 GN=Cdc42ep5 PE=1 SV=2
9	Q8JZX9	8.86e-12	66.2	214	0.202	0.336	BORG1_MOUSE Cdc42 effector protein 2 OS=Mus musculus OX=10090 GN=Cdc42ep2 PE=1 SV=1
10	O14613	3.54e-10	61.2	210	0.197	0.333	BORG1_HUMAN Cdc42 effector protein 2 OS=Homo sapiens OX=9606 GN=CDC42EP2 PE=1 SV=1
11	Q9UKI2	1.17e-09	60.5	254	0.205	0.287	BORG2_HUMAN Cdc42 effector protein 3 OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=1
12	C9JEZ4	5.75e-07	52.0	215	0.065	0.107	C9JEZ4_HUMAN CDC42 effector protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=8
13	Q9CQC5	9.17e-07	52.0	254	0.065	0.091	BORG2_MOUSE Cdc42 effector protein 3 OS=Mus musculus OX=10090 GN=Cdc42ep3 PE=1 SV=1
14	Q9I7F7	3.99e-05	48.1	1337	0.067	0.018	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
15	G5EBZ8	0.083	37.4	1043	0.042	0.014	ARK1_CAEEL Ack-related non-receptor tyrosine kinase OS=Caenorhabditis elegans OX=6239 GN=ark-1 PE=2 SV=1
16	Q94CK1	2.9	32.3	376	0.107	0.101	Q94CK1_ARATH At5g12410 OS=Arabidopsis thaliana OX=3702 GN=At5g12410 PE=1 SV=1
17	Q5AK66	3.4	32.3	1070	0.053	0.018	PSD2_CANAL Phosphatidylserine decarboxylase proenzyme 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PSD2 PE=3 SV=2
18	O74862	4.2	31.6	260	0.079	0.108	UTP23_SCHPO rRNA-processing protein utp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp23 PE=3 SV=1
19	Q9S784	7.5	30.4	184	0.031	0.060	HA22C_ARATH HVA22-like protein c OS=Arabidopsis thaliana OX=3702 GN=HVA22C PE=2 SV=1
20	A0A2R8QCI3	7.8	31.2	2023	0.045	0.008	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14957 BORG_CEP	1.4e-17	76.4	Cdc42 effector
2	PF00786 PBD	4.1e-09	48.0	P21-Rho-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341524	0.904	Septin-6
2	9606.ENSP00000383118	0.904	Cell division control protein 42 homolog
3	9606.ENSP00000391249	0.899	Septin-9
4	9606.ENSP00000381992	0.883	Septin-7
5	9606.ENSP00000391311	0.841	Septin-5
6	9606.ENSP00000479861	0.836	Septin-2
7	9606.ENSP00000367991	0.833	Septin-8
8	9606.ENSP00000402000	0.829	Septin-4
9	9606.ENSP00000264893	0.822	Septin-11
10	9606.ENSP00000238738	0.809	Rho-related GTP-binding protein RhoQ
11	9606.ENSP00000380824	0.805	Septin-10
12	9606.ENSP00000379704	0.798	Neuronal-specific septin-3
13	9606.ENSP00000258214	0.770	Coiled-coil domain containing 102A
14	9606.ENSP00000373627	0.680	Septin-14
15	9606.ENSP00000287218	0.619	Zinc finger AN1-type containing 3
16	9606.ENSP00000341189	0.561	Focal adhesion kinase 1
17	9606.ENSP00000222968	0.556	28 kDa heat- and acid-stable phosphoprotein
18	9606.ENSP00000446100	0.534	C-Maf-inducing protein
19	9606.ENSP00000200181	0.524	Integrin beta-4
20	9606.ENSP00000339916	0.522	LIM domain kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.995	organic cyclic compound binding
GO:1901363	0.994	heterocyclic compound binding
GO:0003676	0.858	nucleic acid binding
GO:0003723	0.821	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060491	0.968	regulation of cell projection assembly
GO:0048522	0.956	positive regulation of cellular process
GO:0120035	0.948	regulation of plasma membrane bounded cell projection organization
GO:0022604	0.942	regulation of cell morphogenesis
GO:0120032	0.942	regulation of plasma membrane bounded cell projection assembly
GO:0008360	0.915	regulation of cell shape
GO:0009987	0.821	cellular process
GO:0051130	0.672	positive regulation of cellular component organization
GO:0044089	0.656	positive regulation of cellular component biogenesis
GO:0120034	0.629	positive regulation of plasma membrane bounded cell projection assembly
GO:0050896	0.508	response to stimulus
GO:0051716	0.380	cellular response to stimulus
GO:0023052	0.368	signaling
GO:0007154	0.368	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	1.000	cytoskeleton
GO:0005886	0.999	plasma membrane
GO:0015629	0.991	actin cytoskeleton
GO:0005829	0.987	cytosol
GO:0015630	0.987	microtubule cytoskeleton
GO:0030054	0.787	cell junction
GO:0043227	0.723	membrane-bounded organelle
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0070161	0.311	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]