StarFunc result for job id Q9H3Q3

User Input

>input (398 residues)
MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTH
KTASSTVLNILYRFAETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLR
FNLPQVQKVMPNDTFYFSILRNPVFQLESSFIYYKTYAPAFRGAPSLDAFLASPRTFYND
SRHLRNVYAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLLRRR
LRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDWRLYEHFNRTLWAQLRAELGP
RRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADILGYNLRPGLDN
QTLGVCQRLVMPELQYMARLYALQFPEKPLKNIPFLGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H3Q3	1.000	1.000	2.010E-78	398	1.000	1.000	Q9H3Q3.pdb.gz	G3ST2_HUMAN Galactose-3-O-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=GAL3ST2 PE=1 SV=2
2	AFDB:Q6XQH0	0.898	0.907	1.438E-58	394	0.668	0.675	Q6XQH0.pdb.gz	G3ST2_MOUSE Galactose-3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Gal3st2 PE=2 SV=1
3	AFDB:Q96RP7	0.804	0.661	1.802E-38	486	0.427	0.350	Q96RP7.pdb.gz	G3ST4_HUMAN Galactose-3-O-sulfotransferase 4 OS=Homo sapiens OX=9606 GN=GAL3ST4 PE=1 SV=1
4	AFDB:Q96A11	0.839	0.777	2.132E-38	431	0.392	0.362	Q96A11.pdb.gz	G3ST3_HUMAN Galactose-3-O-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=GAL3ST3 PE=1 SV=1
5	AFDB:Q99999	0.797	0.751	4.345E-35	423	0.344	0.324	Q99999.pdb.gz	G3ST1_HUMAN Galactosylceramide sulfotransferase OS=Homo sapiens OX=9606 GN=GAL3ST1 PE=1 SV=1
6	AFDB:Q9JHE4	0.807	0.761	1.667E-34	423	0.337	0.317	Q9JHE4.pdb.gz	G3ST1_MOUSE Galactosylceramide sulfotransferase OS=Mus musculus OX=10090 GN=Gal3st1 PE=1 SV=2
7	AFDB:Q8BUB6	0.406	0.398	1.214E-7	407	0.141	0.138	Q8BUB6.pdb.gz	UST_MOUSE Uronyl 2-sulfotransferase OS=Mus musculus OX=10090 GN=Ust PE=2 SV=3
8	AFDB:A1L1P8	0.403	0.447	1.141E-6	354	0.103	0.116	A1L1P8.pdb.gz	A1L1P8_DANRE Heparan sulfate 2-O-sulfotransferase 1 OS=Danio rerio OX=7955 GN=HS2st1 PE=1 SV=1
9	AFDB:P25722	0.393	0.440	2.958E-6	349	0.141	0.160	P25722.pdb.gz	HS2ST_DROME Heparin sulfate O-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=Hs2st PE=2 SV=2
10	AFDB:O08889	0.410	0.452	7.250E-6	356	0.118	0.132	O08889.pdb.gz	HS2ST_CRILO Heparan sulfate 2-O-sulfotransferase 1 OS=Cricetulus longicaudatus OX=10030 GN=HS2ST1 PE=1 SV=1
11	PDB:3f5fA	0.407	0.263	8.154E-6	656	0.108	0.066	3f5fA.pdb.gz	Redirecting the substrate specificity of heparan sulfate 2-O-sulfotransferase by structurally guided mutagenesis.
12	PDB:5t05B	0.345	0.218	9.593E-5	677	0.138	0.081	5t05B.pdb.gz	Structure Based Substrate Specificity Analysis of Heparan Sulfate 6-O-Sulfotransferases.
13	PDB:2gwhB	0.264	0.337	5.095E-2	288	0.055	0.076	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
14	PDB:3mgbA	0.239	0.305	7.541E-2	286	0.095	0.133	3mgbA.pdb.gz	Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
15	PDB:1q44A	0.224	0.284	8.922E-2	284	0.085	0.120	1q44A.pdb.gz
16	PDB:3ndbB	0.170	0.163	1.116E-1	420	0.098	0.093	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
17	PDB:2ad1A	0.249	0.366	1.181E-1	244	0.058	0.094	2ad1A.pdb.gz
18	PDB:3u3kA	0.237	0.301	1.181E-1	289	0.090	0.125	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
19	PDB:1zd1A	0.234	0.338	1.397E-1	251	0.103	0.163	1zd1A.pdb.gz
20	PDB:1zrhA	0.313	0.424	1.477E-1	263	0.095	0.144	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6XQH0	0.0	533	394	0.671	0.678	G3ST2_MOUSE Galactose-3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Gal3st2 PE=2 SV=1
2	Q9H3Q3	0.0	812	398	1.000	1.000	G3ST2_HUMAN Galactose-3-O-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=GAL3ST2 PE=1 SV=2
3	Q96RP7	1.17e-78	252	486	0.430	0.352	G3ST4_HUMAN Galactose-3-O-sulfotransferase 4 OS=Homo sapiens OX=9606 GN=GAL3ST4 PE=1 SV=1
4	Q99999	1.77e-74	239	423	0.344	0.324	G3ST1_HUMAN Galactosylceramide sulfotransferase OS=Homo sapiens OX=9606 GN=GAL3ST1 PE=1 SV=1
5	Q9JHE4	5.86e-72	233	423	0.347	0.326	G3ST1_MOUSE Galactosylceramide sulfotransferase OS=Mus musculus OX=10090 GN=Gal3st1 PE=1 SV=2
6	Q96A11	5.01e-67	220	431	0.377	0.348	G3ST3_HUMAN Galactose-3-O-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=GAL3ST3 PE=1 SV=1
7	D2AV87	4.5	31.6	333	0.048	0.057	4HYPE_STRRD 4-hydroxyproline 2-epimerase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) OX=479432 GN=Sros_6004 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06990 Gal-3-0_sulfotr	9.1e-193	652.2	Galactose-3-O-sulfotransferase
2	PF03567 Sulfotransfer_2	0.22	23.2	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000192314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320318	0.925	Sialidase-4
2	9606.ENSP00000304802	0.829	Thymidylate kinase
3	9606.ENSP00000338783	0.694	Carbohydrate sulfotransferase 5
4	9606.ENSP00000233840	0.647	Sialidase-2
5	9606.ENSP00000305603	0.561	Galactoside 3(4)-L-fucosyltransferase
6	9606.ENSP00000324741	0.554	Uncharacterized protein C7orf43
7	9606.ENSP00000300303	0.552	Probable N-acetyltransferase 16
8	9606.ENSP00000434552	0.531	Mastermind-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008146	1.000	sulfotransferase activity
GO:0005515	0.999	protein binding
GO:0050694	0.814	galactose 3-O-sulfotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:1901135	0.988	carbohydrate derivative metabolic process
GO:0019538	0.985	protein metabolic process
GO:0044260	0.978	cellular macromolecule metabolic process
GO:0009101	0.973	glycoprotein biosynthetic process
GO:0006790	0.928	sulfur compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.958	endomembrane system
GO:0043231	0.859	intracellular membrane-bounded organelle
GO:0005737	0.830	cytoplasm
GO:0031090	0.609	organelle membrane
GO:0098588	0.563	bounding membrane of organelle
GO:0005794	0.366	Golgi apparatus
GO:0000139	0.345	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.-	1.000	Sulfotransferases.

[back to server]