StarFunc result for job id Q9H3R0

User Input

>input (1056 residues)
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFL8	0.380	0.368	0.000	1096	0.548	0.528	A0A0C4DFL8.pdb.gz	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	AFDB:A0A2R8QE74	0.334	0.359	0.000	982	0.478	0.514	A0A2R8QE74.pdb.gz
3	AFDB:F1QNG0	0.483	0.487	0.000	1045	0.511	0.517	F1QNG0.pdb.gz	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
4	AFDB:F1QPD2	0.597	0.444	0.000	1482	0.598	0.426	F1QPD2.pdb.gz
5	AFDB:F5GX28	0.382	0.359	0.000	1130	0.553	0.517	F5GX28.pdb.gz	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
6	AFDB:M0RB75	0.542	0.524	0.000	1099	0.547	0.526	M0RB75.pdb.gz	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
7	AFDB:O75164	0.545	0.542	0.000	1064	0.542	0.538	O75164.pdb.gz	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
8	AFDB:Q8VCD7	0.401	0.402	0.000	1054	0.845	0.846	Q8VCD7.pdb.gz	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
9	AFDB:Q9H3R0	1.000	1.000	0.000	1056	1.000	1.000	Q9H3R0.pdb.gz	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2
10	AFDB:Q3U2K5	0.334	0.686	3.655E-59	510	0.251	0.520	Q3U2K5.pdb.gz	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
11	PDB:7yxgA	0.143	0.412	2.162E-7	313	0.039	0.131	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
12	PDB:3al5B	0.159	0.453	1.236E-6	311	0.031	0.106	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:3al5C	0.141	0.424	1.714E-6	284	0.035	0.130	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	PDB:5nfnB	0.154	0.416	5.383E-6	318	0.035	0.116	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
15	PDB:4qszA	0.162	0.235	1.035E-5	686	0.032	0.050	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
16	PDB:4b7eA	0.144	0.360	4.760E-5	349	0.037	0.112	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
17	PDB:4cclB	0.110	0.272	4.209E-4	372	0.027	0.075	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:6imcD	0.079	0.209	5.837E-4	340	0.022	0.068	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.
19	PDB:2fdjA	0.075	0.315	1.833E-3	207	0.011	0.058	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
20	PDB:4bu2A	0.089	0.223	3.161E-3	379	0.019	0.053	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFL8	654	1096	0.274	0.264	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	A0A0G2JXG2	651	1086	0.273	0.265	A0A0G2JXG2_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=2
3	A0A0G2K5I7	631	1062	0.263	0.262	A0A0G2K5I7_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=3 SV=1
4	A0A8I5ZWQ3	650	1055	0.277	0.278	A0A8I5ZWQ3_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
5	A0A8I6A3B2	1715	978	0.778	0.840	A0A8I6A3B2_RAT Lysine demethylase 4C OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=4 SV=1
6	A0A8I6A8Y8	1821	1009	0.832	0.871	A0A8I6A8Y8_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=1
7	A0A8I6GK41	650	1021	0.273	0.282	A0A8I6GK41_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
8	A2RRT0	609	1482	0.284	0.202	A2RRT0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=wu:fd55d07 PE=2 SV=1
9	B0BNJ6	551	261	0.244	0.989	B0BNJ6_RAT Jmjd2c protein OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=2 SV=1
10	F1LS62	1859	1050	0.846	0.850	F1LS62_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=4
11	F1QNG0	610	1045	0.254	0.256	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
12	F5GX28	654	1130	0.277	0.259	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
13	M0RB75	652	1099	0.277	0.267	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
14	O75164	630	1064	0.264	0.262	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
15	O94953	654	1096	0.274	0.264	KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=4
16	Q3U2K5	556	510	0.243	0.504	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
17	Q8BW72	632	1064	0.263	0.261	KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus OX=10090 GN=Kdm4a PE=1 SV=3
18	Q8VCD7	1861	1054	0.846	0.847	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
19	Q91VY5	652	1086	0.274	0.266	KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus OX=10090 GN=Kdm4b PE=2 SV=1
20	Q9H3R0	2210	1056	1.000	1.000	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09038 53-BP1_Tudor	4	18.8	Tumour suppressor p53-binding protein-1 Tudor
2	PF15382 DUF4609	2.7e+02	12.9	Domain of unknown function (DUF4609)
3	PF02373 JmjC	7.1e-41	150.6	JmjC domain, hydroxylase
4	PF02375 JmjN	2.2e-08	45.0	jmjN domain
5	PF09465 LBR_tudor	4	18.6	Lamin-B receptor of TUDOR domain
6	PF00628 PHD	0.2	22.9	PHD-finger
7	PF13831 PHD_2	2e-09	48.1	PHD-finger
8	PF18104 Tudor_2	1.1e-27	106.7	Jumonji domain-containing protein 2A Tudor domain
9	PF18115 Tudor_3	9.5	17.5	DNA repair protein Crb2 Tudor domain
10	PF18359 Tudor_5	99	14.2	Histone methyltransferase Tudor domain 1
11	PF13771 zf-HC5HC2H	1.9e-13	61.7	PHD-like zinc-binding domain
12	PF13832 zf-HC5HC2H_2	6.9e-33	124.4	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386660	0.807	Lysine-specific demethylase 3A
2	9606.ENSP00000442382	0.800	Lysine-specific demethylase 4C
3	9606.ENSP00000382204	0.795	Probable JmjC domain-containing histone demethylation protein 2C
4	9606.ENSP00000383042	0.779	Lysine-specific histone demethylase 1A
5	9606.ENSP00000363822	0.752	Androgen receptor
6	9606.ENSP00000254846	0.751	Lysine-specific demethylase 6B
7	9606.ENSP00000380692	0.749	Lysine-specific demethylase 7A
8	9606.ENSP00000367203	0.745	Lysine-specific demethylase 6A
9	9606.ENSP00000432786	0.737	Lysine-specific demethylase 2A
10	9606.ENSP00000366271	0.728	Lysine-specific demethylase 2B
11	9606.ENSP00000350676	0.680	Histone lysine demethylase PHF8
12	9606.ENSP00000326563	0.652	Lysine-specific demethylase 3B
13	9606.ENSP00000337976	0.648	Histone-lysine N-methyltransferase SUV39H1
14	9606.ENSP00000437955	0.646	Hypoxia-inducible factor 1-alpha
15	9606.ENSP00000476960	0.632	Histone cluster 2 H3 pseudogene 2
16	9606.ENSP00000364678	0.631	Histone-lysine N-methyltransferase EHMT2
17	9606.ENSP00000229307	0.605	Homeobox protein NANOG
18	9606.ENSP00000307208	0.597	Nucleosome-remodeling factor subunit BPTF
19	9606.ENSP00000398410	0.591	JmjC domain-containing protein 5
20	9606.ENSP00000386759	0.585	Histone-lysine N-methyltransferase SETD2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032454	1.000	histone H3K9 demethylase activity
GO:0016706	0.997	2-oxoglutarate-dependent dioxygenase activity
GO:0016922	0.996	nuclear receptor binding
GO:0019899	0.994	enzyme binding
GO:0050681	0.994	nuclear androgen receptor binding
GO:0008270	0.987	zinc ion binding
GO:0140684	0.777	histone H3K9me2/H3K9me3 demethylase activity
GO:0051864	0.685	histone H3K36 demethylase activity
GO:0003682	0.504	chromatin binding
GO:0042393	0.500	histone binding
GO:1901363	0.335	heterocyclic compound binding
GO:0097159	0.335	organic cyclic compound binding
GO:0003676	0.331	nucleic acid binding
GO:0003677	0.300	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048518	0.984	positive regulation of biological process
GO:0010468	0.984	regulation of gene expression
GO:0008152	0.958	metabolic process
GO:0048522	0.937	positive regulation of cellular process
GO:0071704	0.876	organic substance metabolic process
GO:0051171	0.856	regulation of nitrogen compound metabolic process
GO:0019219	0.846	regulation of nucleobase-containing compound metabolic process
GO:0050793	0.843	regulation of developmental process
GO:0044238	0.841	primary metabolic process
GO:0006807	0.784	nitrogen compound metabolic process
GO:0010604	0.777	positive regulation of macromolecule metabolic process
GO:0010628	0.751	positive regulation of gene expression
GO:0043170	0.747	macromolecule metabolic process
GO:0010556	0.670	regulation of macromolecule biosynthetic process
GO:0031326	0.668	regulation of cellular biosynthetic process
GO:0045597	0.665	positive regulation of cell differentiation
GO:0006355	0.655	regulation of DNA-templated transcription
GO:0043412	0.636	macromolecule modification
GO:0036211	0.627	protein modification process
GO:0070988	0.506	demethylation
GO:0006357	0.461	regulation of transcription by RNA polymerase II
GO:0009987	0.443	cellular process
GO:0048519	0.377	negative regulation of biological process
GO:0048583	0.359	regulation of response to stimulus
GO:0016570	0.325	histone modification
GO:0048523	0.309	negative regulation of cellular process
GO:0009966	0.307	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0005634	0.993	nucleus
GO:0031981	0.978	nuclear lumen
GO:0005654	0.959	nucleoplasm
GO:0098687	0.437	chromosomal region
GO:0032991	0.384	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.997	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:60200	0.777	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(9)-[histone H3] + 2 succinate
EC:1.14.11.66	0.777	[histone H3]-trimethyl-L-lysine(9) demethylase.

[back to server]