StarFunc result for job id Q9H3S1

User Input

>input (761 residues)
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREH
VKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCE
TLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62178	0.859	0.860	0.000	760	0.840	0.841	Q62178.pdb.gz	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
2	AFDB:Q9H3S1	1.000	1.000	0.000	761	1.000	1.000	Q9H3S1.pdb.gz	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
3	AFDB:Q62179	0.753	0.699	9.196E-76	823	0.385	0.356	Q62179.pdb.gz	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
4	AFDB:Q9C0C4	0.738	0.677	4.127E-71	833	0.348	0.318	Q9C0C4.pdb.gz	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
5	AFDB:Q64151	0.737	0.674	6.620E-71	834	0.343	0.313	Q64151.pdb.gz	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
6	AFDB:O09126	0.736	0.654	4.257E-67	861	0.359	0.317	O09126.pdb.gz	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
7	AFDB:Q9NTN9	0.728	0.664	7.994E-67	838	0.332	0.302	Q9NTN9.pdb.gz	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
8	AFDB:Q92854	0.732	0.649	1.771E-65	862	0.332	0.294	Q92854.pdb.gz	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
9	AFDB:Q9Z123	0.699	0.685	2.863E-64	777	0.321	0.314	Q9Z123.pdb.gz	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
10	AFDB:A0A2R8Q5P4	0.751	0.756	3.065E-62	756	0.289	0.291	A0A2R8Q5P4.pdb.gz
11	PDB:6qp7A	0.673	0.818	5.894E-47	620	0.223	0.274	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.634	0.806	6.663E-38	588	0.212	0.274	3nvqA.pdb.gz
13	PDB:3nvnA	0.434	0.828	4.996E-21	383	0.099	0.196	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.405	0.412	7.502E-16	747	0.125	0.127	6vxkB.pdb.gz
15	PDB:2hesX	0.288	0.634	2.944E-8	308	0.051	0.127	2hesX.pdb.gz
16	PDB:5y31B	0.261	0.365	1.949E-7	511	0.051	0.076	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
17	PDB:7mq8LN	0.151	0.169	3.473E-7	671	0.074	0.083	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:2vduD	0.263	0.488	5.571E-7	376	0.053	0.106	2vduD.pdb.gz
19	PDB:7wb4c	0.301	0.597	6.874E-7	346	0.067	0.147	7wb4c.pdb.gz
20	PDB:7ajuCH	0.273	0.420	2.300E-6	467	0.081	0.133	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62178	0.0	1303	760	0.837	0.838	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
2	Q9H3S1	0.0	1576	761	1.000	1.000	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
3	Q62179	2.50e-150	461	823	0.361	0.334	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
4	Q9C0C4	4.28e-128	403	833	0.325	0.297	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
5	Q64151	8.70e-127	400	834	0.317	0.289	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
6	O09126	5.68e-126	399	861	0.338	0.298	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
7	Q92854	1.95e-122	389	862	0.322	0.284	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
8	Q9WUH7	8.25e-107	347	837	0.307	0.280	SEM4G_MOUSE Semaphorin-4G OS=Mus musculus OX=10090 GN=Sema4g PE=1 SV=1
9	Q9NTN9	4.15e-105	343	838	0.305	0.277	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
10	O95754	2.91e-104	339	770	0.300	0.296	SEM4F_HUMAN Semaphorin-4F OS=Homo sapiens OX=9606 GN=SEMA4F PE=2 SV=2
11	Q9Z143	2.27e-100	328	776	0.286	0.281	SEM4F_RAT Semaphorin-4F OS=Rattus norvegicus OX=10116 GN=Sema4f PE=1 SV=1
12	Q9W7J1	1.34e-99	328	860	0.283	0.250	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1
13	Q9Z123	8.49e-99	325	777	0.288	0.282	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
14	Q63548	1.21e-94	313	772	0.267	0.263	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
15	O08665	1.28e-93	310	772	0.265	0.262	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
16	Q14563	2.33e-92	307	771	0.267	0.263	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
17	Q90607	2.48e-92	307	772	0.259	0.255	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1
18	F1NVZ5	4.89e-92	307	808	0.259	0.244	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
19	Q9W6G6	4.99e-92	306	764	0.289	0.288	SEM3D_DANRE Semaphorin-3D OS=Danio rerio OX=7955 GN=sema3d PE=2 SV=1
20	Q9W686	1.82e-90	302	778	0.273	0.267	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01437 PSI	0.0077	28.1	Plexin repeat
2	PF01403 Sema	2.5e-50	182.4	Sema domain
3	PF19428 Sema4F_C	1.1e+02	13.6	Semaphorin 4F C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317128	0.998	Plexin-D1
2	9606.ENSP00000265371	0.989	Neuropilin-1
3	9606.ENSP00000351338	0.866	Plexin-B1
4	9606.ENSP00000409171	0.865	Plexin-B2
5	9606.ENSP00000442736	0.854	Plexin-B3
6	9606.ENSP00000375629	0.791	Leukocyte immunoglobulin-like receptor subfamily B member 2
7	9606.ENSP00000353582	0.754	Neuropilin-2
8	9606.ENSP00000344844	0.711	Hepatitis A virus cellular receptor 1
9	9606.ENSP00000478570	0.701	Vascular endothelial growth factor A
10	9606.ENSP00000173229	0.671	Netrin-1
11	9606.ENSP00000226760	0.656	Wolframin
12	9606.ENSP00000379980	0.643	B-cell differentiation antigen CD72
13	9606.ENSP00000315379	0.605	U4/U6 small nuclear ribonucleoprotein Prp3
14	9606.ENSP00000262483	0.604	Membrane-associated phosphatidylinositol transfer protein 3
15	9606.ENSP00000407560	0.594	Solute carrier family 25 member 44
16	9606.ENSP00000275815	0.576	Ephrin type-A receptor 1
17	9606.ENSP00000376753	0.573	PDZ domain-containing protein GIPC1
18	9606.ENSP00000332164	0.569	Slit homolog 3 protein
19	9606.ENSP00000337838	0.560	Reticulon-4
20	9606.ENSP00000378394	0.551	Prosaposin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0048856	0.990	anatomical structure development
GO:0022603	0.988	regulation of anatomical structure morphogenesis
GO:0032501	0.980	multicellular organismal process
GO:0007275	0.902	multicellular organism development
GO:0051128	0.895	regulation of cellular component organization
GO:0051716	0.884	cellular response to stimulus
GO:0048731	0.852	system development
GO:0071840	0.842	cellular component organization or biogenesis
GO:0016043	0.832	cellular component organization
GO:0048518	0.823	positive regulation of biological process
GO:0030154	0.818	cell differentiation
GO:0048523	0.803	negative regulation of cellular process
GO:0048468	0.769	cell development
GO:0009653	0.766	anatomical structure morphogenesis
GO:0048522	0.763	positive regulation of cellular process
GO:0051239	0.762	regulation of multicellular organismal process
GO:0051130	0.741	positive regulation of cellular component organization
GO:0007165	0.737	signal transduction
GO:0007399	0.722	nervous system development
GO:0007166	0.692	cell surface receptor signaling pathway
GO:0032990	0.675	cell part morphogenesis
GO:2000026	0.662	regulation of multicellular organismal development
GO:0051094	0.662	positive regulation of developmental process
GO:0051240	0.614	positive regulation of multicellular organismal process
GO:0065008	0.583	regulation of biological quality
GO:0002521	0.579	leukocyte differentiation
GO:0120036	0.575	plasma membrane bounded cell projection organization
GO:0048666	0.559	neuron development
GO:0071526	0.557	semaphorin-plexin signaling pathway
GO:0046649	0.544	lymphocyte activation
GO:0050803	0.533	regulation of synapse structure or activity
GO:0031175	0.524	neuron projection development
GO:0000902	0.518	cell morphogenesis
GO:0040012	0.510	regulation of locomotion
GO:0046631	0.483	alpha-beta T cell activation
GO:0050807	0.446	regulation of synapse organization
GO:0051093	0.421	negative regulation of developmental process
GO:0051960	0.418	regulation of nervous system development
GO:0044087	0.415	regulation of cellular component biogenesis
GO:0048583	0.396	regulation of response to stimulus
GO:1901888	0.391	regulation of cell junction assembly
GO:0006955	0.382	immune response
GO:0048858	0.360	cell projection morphogenesis
GO:2000145	0.356	regulation of cell motility
GO:1903131	0.356	mononuclear cell differentiation
GO:0030334	0.339	regulation of cell migration
GO:0002285	0.335	lymphocyte activation involved in immune response
GO:0030217	0.335	T cell differentiation
GO:0019222	0.327	regulation of metabolic process
GO:0120039	0.313	plasma membrane bounded cell projection morphogenesis
GO:0002250	0.305	adaptive immune response
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.876	intracellular anatomical structure
GO:0043226	0.724	organelle
GO:0005737	0.704	cytoplasm
GO:0043227	0.701	membrane-bounded organelle
GO:0043229	0.654	intracellular organelle
GO:0005576	0.500	extracellular region
GO:0005615	0.322	extracellular space
GO:0043231	0.317	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]