StarFunc result for job id Q9H3S7

User Input

>input (1636 residues)
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQ
LMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQA
GAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAAL
PTPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKK
LFEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVA
SYEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRP
TAPKPLLPRREESEAVEAGDPPEELRSLPPDMVAGPRLPDTFLGSATPLHFPPSPFPSST
GPGPHYLSGPLPPGTYSGPTQLIQPRAPGPHAMPVAPGPALYPAPAYTPELGLVPRSSPQ
HGVVSSPYVGVGPAPPVAGLPSAPPPQFSGPELAMAVRPATTTVDSIQAPIPSHTAPRPN
PTPAPPPPCFPVPPPQPLPTPYTYPAGAKQPIPAQHHFSSGIPAGFPAPRIGPQPQPHPQ
PHPSQAFGPQPPQQPLPLQHPHLFPPQAPGLLPPQSPYPYAPQPGVLGQPPPPLHTQLYP
GPAQDPLPAHSGALPFPSPGPPQPPHPPLAYGPAPSTRPMGPQAAPLTIRGPSSAGQSTP
SPHLVPSPAPSPGPGPVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGGTQSPGGGQPL
LQPTKVDAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQD
AQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLV
ATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLAL
SSVRSTETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLH
QRPLHTPIIVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKL
HLRFCYEAVVRHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQA
TIAKLSIRPPGGLESPVASLPGPAEPPGLPPASLPESTPIPSSSPPPLSSPLPEAPQPKE
EPPVPEAPSSGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKHNFLQAHNGQGLRATRPS
DDPLSLLDPLWTLNKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PB44	0.559	0.543	0.000	1692	0.915	0.885	Q6PB44.pdb.gz	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2
2	AFDB:Q9H3S7	1.000	1.000	0.000	1636	1.000	1.000	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
3	AFDB:Q9VUH6	0.320	0.289	1.127E-68	1833	0.300	0.267	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
4	PDB:6krwA	0.156	0.766	2.588E-17	306	0.057	0.307	6krwA.pdb.gz
5	AFDB:Q62130	0.152	0.205	3.084E-17	1189	0.106	0.146	Q62130.pdb.gz	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
6	PDB:4gwfA	0.163	0.520	1.230E-16	497	0.051	0.169	4gwfA.pdb.gz
7	PDB:5xzrA	0.164	0.500	1.651E-16	519	0.053	0.166	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
8	PDB:3ps5A	0.157	0.470	1.722E-16	529	0.047	0.146	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
9	AFDB:Q62656	0.161	0.114	3.861E-16	2316	0.096	0.068	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
10	AFDB:P23471	0.159	0.114	1.996E-15	2315	0.094	0.067	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
11	PDB:3m4uA	0.150	0.793	4.732E-13	285	0.045	0.260	3m4uA.pdb.gz
12	PDB:3zxpA	0.176	0.643	2.280E-11	394	0.041	0.170	3zxpA.pdb.gz
13	AFDB:F4IAT2	0.067	0.062	3.259E-4	1823	0.112	0.100	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
14	AFDB:P29539	0.058	0.052	1.911E-3	1916	0.085	0.073	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
15	AFDB:Q57XT6	0.052	0.080	4.629E-3	966	0.090	0.153	Q57XT6.pdb.gz	Q57XT6_TRYB2 Dual specificity protein phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.190 PE=4 SV=1
16	PDB:5xjvB	0.078	0.571	8.291E-3	171	0.021	0.205	5xjvB.pdb.gz
17	AFDB:A0A166B1A6	0.049	0.067	2.109E-2	1119	0.100	0.147	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
18	PDB:3s4oA	0.078	0.623	2.278E-2	163	0.018	0.178	3s4oA.pdb.gz
19	PDB:2esbA	0.074	0.578	3.328E-2	162	0.017	0.173	2esbA.pdb.gz
20	PDB:4ercA	0.070	0.584	4.863E-2	150	0.020	0.213	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PB44	0.0	2755	1692	0.908	0.878	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2
2	Q9H3S7	0.0	3300	1636	1.000	1.000	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
3	Q960G3	2.26e-156	525	1838	0.176	0.157	Q960G3_DROME SD03094p OS=Drosophila melanogaster OX=7227 GN=mop PE=2 SV=1
4	Q9VUH6	3.46e-156	524	1833	0.176	0.157	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
5	G5EBN5	5.81e-88	319	1492	0.129	0.141	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
6	H8ESG1	5.82e-88	319	1494	0.130	0.143	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
7	Q8T7K0	4.71e-63	234	794	0.114	0.234	ALIX_DICDI ALG-2 interacting protein X OS=Dictyostelium discoideum OX=44689 GN=alxA PE=1 SV=1
8	Q8WUM4	2.97e-58	220	868	0.122	0.230	PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1
9	Q9QZA2	8.24e-58	219	873	0.121	0.227	PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus OX=10116 GN=Pdcd6ip PE=1 SV=2
10	Q80Y09	2.37e-57	218	872	0.120	0.225	Q80Y09_MOUSE Pdcd6ip protein OS=Mus musculus OX=10090 GN=Pdcd6ip PE=2 SV=1
11	Q9WU78	3.76e-57	217	869	0.120	0.226	PDC6I_MOUSE Programmed cell death 6-interacting protein OS=Mus musculus OX=10090 GN=Pdcd6ip PE=1 SV=3
12	P79020	5.09e-56	213	847	0.114	0.221	PALA_EMENI pH-response regulator protein palA/RIM20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=palA PE=1 SV=3
13	Q9VB05	2.29e-52	202	836	0.124	0.243	Q9VB05_DROME ALG-2 interacting protein X OS=Drosophila melanogaster OX=7227 GN=ALiX PE=1 SV=1
14	P34552	2.90e-44	177	882	0.111	0.205	ALXA_CAEEL Apoptosis-linked gene 2-interacting protein X 1 OS=Caenorhabditis elegans OX=6239 GN=alx-1 PE=2 SV=3
15	Q06180	7.18e-40	155	406	0.052	0.209	PTN2_MOUSE Tyrosine-protein phosphatase non-receptor type 2 OS=Mus musculus OX=10090 GN=Ptpn2 PE=1 SV=2
16	P35233	2.15e-39	154	416	0.051	0.202	PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ptpn2 PE=1 SV=2
17	P17706	2.90e-39	154	415	0.051	0.200	PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2
18	A8K3N4	1.25e-38	151	387	0.051	0.214	A8K3N4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTN2 PE=2 SV=1
19	F4HXZ1	1.37e-38	159	846	0.111	0.214	BRO1_ARATH Vacuolar-sorting protein BRO1 OS=Arabidopsis thaliana OX=3702 GN=BRO1 PE=1 SV=1
20	Q562B7	1.40e-38	149	306	0.053	0.284	Q562B7_RAT Ptpn3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13949 ALIX_LYPXL_bnd	9.6e-56	200.8	ALIX V-shaped domain binding to HIV
2	PF03097 BRO1	2.1e-119	410.5	BRO1-like domain
3	PF00782 DSPc	2e+02	13.2	Dual specificity phosphatase, catalytic domain
4	PF10552 ORF6C	2.3e+02	13.1	ORF6C domain
5	PF11365 SOGA	5.3e+02	13.1	Protein SOGA
6	PF00102 Y_phosphatase	1.9e-61	219.2	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	0.83	21.2	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324205	0.997	Charged multivesicular body protein 4a
2	9606.ENSP00000263904	0.995	Signal transducing adapter molecule 2
3	9606.ENSP00000297661	0.995	Ubiquitin-associated protein 1
4	9606.ENSP00000217402	0.994	Charged multivesicular body protein 4b
5	9606.ENSP00000339186	0.966	GRB2-related adapter protein 2
6	9606.ENSP00000251968	0.939	Tumor susceptibility gene 101 protein
7	9606.ENSP00000355923	0.929	Tyrosine-protein phosphatase non-receptor type 14
8	9606.ENSP00000263708	0.928	Tyrosine-protein phosphatase non-receptor type 4
9	9606.ENSP00000394794	0.926	Tyrosine-protein phosphatase non-receptor type 13
10	9606.ENSP00000482732	0.922	Tyrosine-protein phosphatase non-receptor type 9
11	9606.ENSP00000311857	0.914	Tyrosine-protein phosphatase non-receptor type 2
12	9606.ENSP00000248594	0.913	Tyrosine-protein phosphatase non-receptor type 12
13	9606.ENSP00000309116	0.913	Tyrosine-protein phosphatase non-receptor type 7
14	9606.ENSP00000363459	0.912	Tyrosine-protein phosphatase non-receptor type 20
15	9606.ENSP00000376345	0.911	Growth factor receptor-bound protein 2
16	9606.ENSP00000351342	0.910	Tyrosine-protein phosphatase non-receptor type 5
17	9606.ENSP00000340944	0.909	Tyrosine-protein phosphatase non-receptor type 11
18	9606.ENSP00000391592	0.909	Tyrosine-protein phosphatase non-receptor type 6
19	9606.ENSP00000175756	0.908	Tyrosine-protein phosphatase non-receptor type 18
20	9606.ENSP00000332973	0.904	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0019899	0.586	enzyme binding
GO:0019900	0.459	kinase binding
GO:0019901	0.440	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.993	cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0044248	0.949	cellular catabolic process
GO:0071840	0.947	cellular component organization or biogenesis
GO:0030163	0.936	protein catabolic process
GO:0051603	0.932	proteolysis involved in protein catabolic process
GO:0016043	0.916	cellular component organization
GO:0048518	0.915	positive regulation of biological process
GO:0048519	0.908	negative regulation of biological process
GO:0048522	0.906	positive regulation of cellular process
GO:0051234	0.893	establishment of localization
GO:0048523	0.882	negative regulation of cellular process
GO:0044085	0.876	cellular component biogenesis
GO:0023051	0.875	regulation of signaling
GO:0010646	0.874	regulation of cell communication
GO:0006996	0.870	organelle organization
GO:0051128	0.861	regulation of cellular component organization
GO:0006810	0.855	transport
GO:0022607	0.855	cellular component assembly
GO:0060341	0.850	regulation of cellular localization
GO:0051641	0.839	cellular localization
GO:0016192	0.821	vesicle-mediated transport
GO:0051049	0.748	regulation of transport
GO:0051050	0.726	positive regulation of transport
GO:0046907	0.726	intracellular transport
GO:0044260	0.723	cellular macromolecule metabolic process
GO:0044265	0.714	cellular macromolecule catabolic process
GO:0016197	0.711	endosomal transport
GO:0006511	0.676	ubiquitin-dependent protein catabolic process
GO:1903829	0.656	positive regulation of protein localization
GO:0070201	0.586	regulation of establishment of protein localization
GO:0051668	0.556	localization within membrane
GO:0070925	0.497	organelle assembly
GO:0043162	0.497	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0051223	0.442	regulation of protein transport
GO:0048583	0.426	regulation of response to stimulus
GO:0050896	0.364	response to stimulus
GO:0036211	0.358	protein modification process
GO:0032456	0.334	endocytic recycling
GO:0032386	0.330	regulation of intracellular transport
GO:0051222	0.317	positive regulation of protein transport
GO:1903649	0.311	regulation of cytoplasmic transport
GO:0060627	0.307	regulation of vesicle-mediated transport
GO:0051239	0.304	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005654	0.998	nucleoplasm
GO:0005615	0.997	extracellular space
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0097708	0.996	intracellular vesicle
GO:0005856	0.993	cytoskeleton
GO:0070062	0.990	extracellular exosome
GO:0005768	0.979	endosome
GO:0005829	0.974	cytosol
GO:0015630	0.936	microtubule cytoskeleton
GO:0016020	0.883	membrane
GO:0120025	0.875	plasma membrane bounded cell projection
GO:0005815	0.834	microtubule organizing center
GO:0005769	0.786	early endosome
GO:0005929	0.560	cilium
GO:0016604	0.544	nuclear body
GO:0036064	0.386	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]