StarFunc result for job id Q9H3T2

User Input

>input (930 residues)
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELG
LDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAI
FAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVQALEHGDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPVTHQPLLTLTSR
ALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLTPGGRSGGPEPILLEEIDAYSPARCS
GKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRCARHGACQRSCLASQDPYCGWH
SSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYGVRRDLPPASASRS
VPIPLLLASVAAAFALGASVSGLLVSCACRRAHRRRGKDIETPGLPRPLSLRSLARLHGG
GPEPPPPSKDGDAVQTPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDPWE
WNQNRNNAKEGPGRSRGGHAAGGPAPRVLVRPPPPGCPGQAVEVTTLEELLRYLHGPQPP
RKGAEPPAPLTSRALPPEPAPALLGGPSPRPHECASPLRLDVPPEGRCASAPARPALSAP
APRLGVGGGRRLPFSGHRAPPALLTRVPSGGPSRYSGGPGKHLLYLGRPEGYRGRALKRV
DVEKPQLSLKPPLVGPSSRQAVPNGGRFNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H3T2	1.000	1.000	0.000	930	1.000	1.000	Q9H3T2.pdb.gz	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
2	AFDB:Q9WTM3	0.715	0.714	0.000	931	0.878	0.878	Q9WTM3.pdb.gz	SEM6C_MOUSE Semaphorin-6C OS=Mus musculus OX=10090 GN=Sema6c PE=2 SV=1
3	AFDB:Q76KF0	0.582	0.506	1.094E-84	1073	0.410	0.355	Q76KF0.pdb.gz	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
4	AFDB:Q9H3T3	0.573	0.600	6.029E-77	888	0.383	0.401	Q9H3T3.pdb.gz	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
5	AFDB:Q1RMY5	0.406	0.696	1.577E-68	537	0.441	0.764	Q1RMY5.pdb.gz	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
6	PDB:6qp7A	0.471	0.698	1.409E-47	620	0.188	0.282	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
7	PDB:3nvqA	0.460	0.709	1.313E-32	588	0.139	0.219	3nvqA.pdb.gz
8	PDB:3nvnA	0.353	0.809	3.735E-19	383	0.073	0.178	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
9	PDB:6vxkB	0.328	0.400	6.547E-15	747	0.087	0.108	6vxkB.pdb.gz
10	AFDB:Q389F7	0.230	0.198	3.149E-7	1105	0.123	0.103	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
11	PDB:6jp6A	0.109	0.103	6.172E-7	998	0.052	0.048	6jp6A.pdb.gz
12	PDB:1kv9A	0.249	0.328	8.518E-7	664	0.074	0.104	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
13	PDB:7d4iBE	0.129	0.134	1.622E-6	890	0.061	0.064	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
14	PDB:5m2nA	0.135	0.168	1.906E-6	711	0.077	0.101	5m2nA.pdb.gz
15	PDB:7d5sBE	0.121	0.129	2.493E-6	865	0.055	0.059	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:7bt6x	0.229	0.403	3.260E-6	488	0.054	0.102	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
17	AFDB:Q9C0J8	0.230	0.167	4.868E-6	1336	0.163	0.114	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
18	AFDB:Q4GZ31	0.226	0.155	3.549E-5	1443	0.130	0.084	Q4GZ31.pdb.gz	Q4GZ31_TRYB2 WD repeat protein mio zinc-ribbon like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1880 PE=4 SV=1
19	AFDB:F1LRR4	0.114	0.081	4.399E-5	1551	0.128	0.077	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
20	AFDB:Q09847	0.205	0.150	3.039E-4	1325	0.096	0.067	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E3W9A6	0.0	736	1064	0.489	0.428	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
2	O35464	0.0	592	1031	0.351	0.316	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
3	Q1RMY5	0.0	763	537	0.401	0.695	Q1RMY5_HUMAN SEMA6C protein OS=Homo sapiens OX=9606 GN=SEMA6C PE=1 SV=1
4	Q6P7E1	0.0	607	968	0.367	0.352	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
5	Q76KF0	0.0	608	1073	0.317	0.275	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
6	Q8NFY4	0.0	609	1073	0.313	0.271	SEM6D_HUMAN Semaphorin-6D OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
7	Q9H2E6	0.0	582	1030	0.348	0.315	SEM6A_HUMAN Semaphorin-6A OS=Homo sapiens OX=9606 GN=SEMA6A PE=1 SV=3
8	Q9H3T2	0.0	1864	930	1.000	1.000	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
9	Q9WTL3	0.0	1499	960	0.882	0.854	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
10	Q9WTM3	0.0	1518	931	0.878	0.878	SEM6C_MOUSE Semaphorin-6C OS=Mus musculus OX=10090 GN=Sema6c PE=2 SV=1
11	O54951	2.22e-167	513	886	0.284	0.298	SEM6B_MOUSE Semaphorin-6B OS=Mus musculus OX=10090 GN=Sema6b PE=1 SV=1
12	Q9H3T3	3.83e-167	512	888	0.304	0.319	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
13	Q24322	8.41e-101	337	899	0.248	0.257	SEM1A_DROME Semaphorin-1A OS=Drosophila melanogaster OX=7227 GN=Sema1a PE=1 SV=3
14	O44253	2.48e-90	306	770	0.215	0.260	O44253_DROME Similar to semaphorin-I OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=2 SV=1
15	Q7KK54	6.48e-90	305	770	0.215	0.260	Q7KK54_DROME MIP07328p OS=Drosophila melanogaster OX=7227 GN=Sema1b PE=1 SV=1
16	Q62217	6.51e-85	297	1077	0.206	0.178	SEM5A_MOUSE Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1
17	D3ZTD8	1.83e-84	296	1074	0.208	0.180	SEM5A_RAT Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1
18	O08665	1.89e-84	290	772	0.202	0.244	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
19	Q63548	4.65e-84	289	772	0.201	0.242	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
20	Q14563	9.72e-84	288	771	0.199	0.240	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01437 PSI	0.68	21.8	Plexin repeat
2	PF01403 Sema	8.2e-43	157.9	Sema domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377061	0.946	Plexin-A1
2	9606.ENSP00000442736	0.931	Plexin-B3
3	9606.ENSP00000352882	0.930	Plexin-A4
4	9606.ENSP00000356000	0.929	Plexin-A2
5	9606.ENSP00000358696	0.927	Plexin-A3
6	9606.ENSP00000317128	0.916	Plexin-D1
7	9606.ENSP00000258526	0.886	Plexin-C1
8	9606.ENSP00000265371	0.777	Neuropilin-1
9	9606.ENSP00000173229	0.770	Netrin-1
10	9606.ENSP00000353582	0.754	Neuropilin-2
11	9606.ENSP00000328551	0.704	Ras-related protein Rab-28
12	9606.ENSP00000164024	0.686	Cadherin EGF LAG seven-pass G-type receptor 3
13	9606.ENSP00000357040	0.670	Vang-like protein 2
14	9606.ENSP00000271332	0.666	Cadherin EGF LAG seven-pass G-type receptor 2
15	9606.ENSP00000418754	0.664	Inactive tyrosine-protein kinase 7
16	9606.ENSP00000332164	0.655	Slit homolog 3 protein
17	9606.ENSP00000347672	0.653	VANGL planar cell polarity protein 1
18	9606.ENSP00000295902	0.649	Prickle planar cell polarity protein 2
19	9606.ENSP00000478570	0.611	Vascular endothelial growth factor A
20	9606.ENSP00000422591	0.610	Slit homolog 2 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030215	1.000	semaphorin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.986	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0048731	0.982	system development
GO:0050794	0.975	regulation of cellular process
GO:0007399	0.969	nervous system development
GO:0050896	0.961	response to stimulus
GO:0030154	0.941	cell differentiation
GO:0009653	0.928	anatomical structure morphogenesis
GO:0016043	0.920	cellular component organization
GO:0048468	0.893	cell development
GO:0048519	0.838	negative regulation of biological process
GO:0097485	0.836	neuron projection guidance
GO:0120035	0.808	regulation of plasma membrane bounded cell projection organization
GO:0022603	0.803	regulation of anatomical structure morphogenesis
GO:0010975	0.803	regulation of neuron projection development
GO:0048523	0.788	negative regulation of cellular process
GO:0051241	0.763	negative regulation of multicellular organismal process
GO:0000904	0.742	cell morphogenesis involved in differentiation
GO:0007409	0.730	axonogenesis
GO:0050770	0.697	regulation of axonogenesis
GO:0008361	0.661	regulation of cell size
GO:0045926	0.641	negative regulation of growth
GO:0045595	0.640	regulation of cell differentiation
GO:2000026	0.639	regulation of multicellular organismal development
GO:0051129	0.614	negative regulation of cellular component organization
GO:0030308	0.606	negative regulation of cell growth
GO:0061387	0.597	regulation of extent of cell growth
GO:0051093	0.585	negative regulation of developmental process
GO:0050767	0.572	regulation of neurogenesis
GO:0010977	0.555	negative regulation of neuron projection development
GO:0010721	0.550	negative regulation of cell development
GO:0030516	0.531	regulation of axon extension
GO:0048640	0.518	negative regulation of developmental growth
GO:0050771	0.508	negative regulation of axonogenesis
GO:0007411	0.460	axon guidance
GO:0007154	0.380	cell communication
GO:0023052	0.378	signaling
GO:0051716	0.365	cellular response to stimulus
GO:0048518	0.363	positive regulation of biological process
GO:0048522	0.326	positive regulation of cellular process
GO:0030517	0.318	negative regulation of axon extension

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.981	cytoplasm
GO:0071944	0.968	cell periphery
GO:0016020	0.960	membrane
GO:0005886	0.936	plasma membrane
GO:0009986	0.829	cell surface
GO:0043226	0.822	organelle
GO:0043227	0.505	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]