StarFunc result for job id Q9H3U7

User Input

>input (446 residues)
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTF
LSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYS
QVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALET
QPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPEC
AHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQ
LQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLD
KNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG
KADTKKRHTPRGHAESTSNRQPRKQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CD91	0.447	0.446	8.697E-74	447	0.948	0.946	Q8CD91.pdb.gz	SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Smoc2 PE=1 SV=1
2	AFDB:E7FET3	0.452	0.460	5.772E-55	437	0.641	0.654	E7FET3.pdb.gz
3	AFDB:Q8BLY1	0.295	0.286	2.632E-47	463	0.538	0.518	Q8BLY1.pdb.gz	SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Smoc1 PE=2 SV=2
4	AFDB:E7EDQ9	0.297	0.288	3.341E-44	461	0.493	0.477	E7EDQ9.pdb.gz	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1
5	AFDB:Q86MK1	0.252	0.220	4.717E-23	523	0.278	0.237	Q86MK1.pdb.gz	Q86MK1_DROME CG2264A OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
6	AFDB:Q0E9E0	0.257	0.197	1.506E-19	613	0.278	0.202	Q0E9E0.pdb.gz	Q0E9E0_DROME FI05255p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
7	AFDB:A0A0R4IDK4	0.247	0.579	5.078E-17	168	0.202	0.536	A0A0R4IDK4.pdb.gz
8	AFDB:Q8IV28	0.154	0.073	1.634E-10	969	0.110	0.051	Q8IV28.pdb.gz	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
9	AFDB:O88322	0.160	0.053	4.109E-10	1403	0.117	0.037	O88322.pdb.gz	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
10	AFDB:Q14112	0.157	0.054	2.186E-9	1375	0.114	0.037	Q14112.pdb.gz	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
11	PDB:1a2xA	0.144	0.352	1.285E-2	158	0.061	0.171	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
12	PDB:1yu6C	0.079	0.657	1.442E-2	51	0.034	0.294	1yu6C.pdb.gz	Structure of the subtilisin Carlsberg-OMTKY3 complex reveals two different ovomucoid conformations.
13	PDB:2p6aD	0.097	0.143	1.442E-2	292	0.061	0.092	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
14	PDB:3b4vD	0.103	0.203	1.528E-2	213	0.056	0.117	3b4vD.pdb.gz
15	PDB:1s1eA	0.136	0.294	1.714E-2	181	0.063	0.155	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
16	PDB:7ukhI	0.131	0.286	2.038E-2	181	0.065	0.160	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
17	PDB:5aanA	0.131	0.286	2.287E-2	183	0.056	0.137	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
18	PDB:1rroA	0.131	0.449	2.566E-2	108	0.040	0.167	1rroA.pdb.gz	Refinement of recombinant oncomodulin at 1.30 A resolution.
19	PDB:1palA	0.131	0.454	2.880E-2	108	0.043	0.176	1palA.pdb.gz	Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
20	PDB:6hr1A	0.132	0.143	3.051E-2	406	0.034	0.037	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CD91	0.0	805	447	0.948	0.946	SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Smoc2 PE=1 SV=1
2	Q9H3U7	0.0	926	446	1.000	1.000	SMOC2_HUMAN SPARC-related modular calcium-binding protein 2 OS=Homo sapiens OX=9606 GN=SMOC2 PE=1 SV=2
3	Q9H4F8	3.70e-159	458	434	0.529	0.544	SMOC1_HUMAN SPARC-related modular calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=SMOC1 PE=1 SV=1
4	Q8BLY1	1.43e-153	445	463	0.525	0.505	SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Smoc1 PE=2 SV=2
5	E7EDQ9	2.16e-143	419	461	0.484	0.469	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1
6	Q86MK1	8.53e-29	120	523	0.173	0.147	Q86MK1_DROME CG2264A OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
7	A4UZB1	9.90e-29	120	520	0.173	0.148	A4UZB1_DROME Magu, isoform F OS=Drosophila melanogaster OX=7227 GN=magu PE=4 SV=1
8	Q95TQ2	1.35e-28	120	613	0.173	0.126	Q95TQ2_DROME LD30894p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
9	Q0E9E0	2.08e-28	120	613	0.177	0.129	Q0E9E0_DROME FI05255p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
10	B5DFC9	3.17e-14	77.8	1396	0.112	0.036	NID2_RAT Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1
11	P01267	9.20e-14	76.3	2769	0.130	0.021	THYG_BOVIN Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=1
12	P01266	4.36e-13	74.3	2768	0.137	0.022	THYG_HUMAN Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5
13	O88322	8.84e-13	73.2	1403	0.110	0.035	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
14	A0A4X1WD80	4.10e-12	70.9	1348	0.117	0.039	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
15	Q14112	4.91e-12	70.9	1375	0.114	0.037	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
16	Q8IV28	6.95e-12	70.1	969	0.114	0.053	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
17	O08710	1.78e-11	68.9	2766	0.130	0.021	THYG_MOUSE Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 SV=3
18	P06882	1.78e-11	68.9	2768	0.132	0.021	THYG_RAT Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg PE=1 SV=4
19	F1RRV3	1.11e-10	66.6	2692	0.135	0.022	THYG_PIG Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5
20	F1RGY5	7.68e-08	57.4	1309	0.063	0.021	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.097	23.3	EF hand
2	PF13202 EF-hand_5	9.7	17.1	EF hand
3	PF13405 EF-hand_6	0.13	23.2	EF-hand domain
4	PF13499 EF-hand_7	0.034	25.9	EF-hand domain pair
5	PF00050 Kazal_1	43	15.6	Kazal-type serine protease inhibitor domain
6	PF07648 Kazal_2	8.2e-05	34.0	Kazal-type serine protease inhibitor domain
7	PF10591 SPARC_Ca_bdg	3.6e-07	41.9	Secreted protein acidic and rich in cysteine Ca binding region
8	PF00086 Thyroglobulin_1	3.9e-34	127.4	Thyroglobulin type-1 repeat
9	PF16597 Thyroglob_assoc	7.3e-27	104.8	Thyroglobulin_1 repeat associated disordered domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430325	0.801	Contributes to normal sperm motility, but not essential for male fertility
2	9606.ENSP00000355760	0.785	Dapper homolog 2
3	9606.ENSP00000377895	0.772	F-box only protein 38
4	9606.ENSP00000349677	0.746	Testican-3
5	9606.ENSP00000478570	0.665	Vascular endothelial growth factor A
6	9606.ENSP00000347324	0.654	Methionine-R-sulfoxide reductase B3
7	9606.ENSP00000219022	0.628	Olfactomedin-4
8	9606.ENSP00000455041	0.617	Transmembrane channel-like protein 7
9	9606.ENSP00000283309	0.613	FERM domain containing 1
10	9606.ENSP00000355736	0.612	Tctex1 domain-containing protein 3
11	9606.ENSP00000396755	0.608	Cyclin N-terminal domain containing 2
12	9606.ENSP00000332293	0.602	Achaete-scute homolog 2
13	9606.ENSP00000341805	0.600	PHD finger protein 10
14	9606.ENSP00000398744	0.597	Adenosine deaminase-like protein
15	9606.ENSP00000414856	0.591	SPARC-like protein 1
16	9606.ENSP00000266674	0.584	Leucine-rich repeat-containing G-protein coupled receptor 5
17	9606.ENSP00000368102	0.584	Coiled-coil domain-containing protein 3
18	9606.ENSP00000440125	0.571	Constitutive coactivator of peroxisome proliferator-activated receptor gamma
19	9606.ENSP00000325425	0.570	Methionine adenosyltransferase 2 subunit beta
20	9606.ENSP00000256759	0.549	Follistatin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097367	0.995	carbohydrate derivative binding
GO:0005515	0.995	protein binding
GO:0005509	0.978	calcium ion binding
GO:1901681	0.877	sulfur compound binding
GO:0005539	0.875	glycosaminoglycan binding
GO:0008201	0.789	heparin binding
GO:0098772	0.505	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0048583	0.968	regulation of response to stimulus
GO:0048522	0.949	positive regulation of cellular process
GO:0010810	0.938	regulation of cell-substrate adhesion
GO:0010811	0.855	positive regulation of cell-substrate adhesion
GO:0019222	0.762	regulation of metabolic process
GO:0071840	0.738	cellular component organization or biogenesis
GO:0040012	0.710	regulation of locomotion
GO:0023051	0.634	regulation of signaling
GO:0010646	0.634	regulation of cell communication
GO:0016043	0.620	cellular component organization
GO:0048584	0.586	positive regulation of response to stimulus
GO:0032502	0.577	developmental process
GO:0009966	0.560	regulation of signal transduction
GO:2000145	0.543	regulation of cell motility
GO:0048856	0.512	anatomical structure development
GO:0032501	0.510	multicellular organismal process
GO:0030334	0.498	regulation of cell migration
GO:0060255	0.485	regulation of macromolecule metabolic process
GO:0040017	0.477	positive regulation of locomotion
GO:0030198	0.477	extracellular matrix organization
GO:0080090	0.472	regulation of primary metabolic process
GO:0051171	0.421	regulation of nitrogen compound metabolic process
GO:0007275	0.421	multicellular organism development
GO:0051239	0.417	regulation of multicellular organismal process
GO:0090287	0.404	regulation of cellular response to growth factor stimulus
GO:1903034	0.402	regulation of response to wounding
GO:0031323	0.358	regulation of cellular metabolic process
GO:0050896	0.337	response to stimulus
GO:0048519	0.313	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0005576	0.989	extracellular region
GO:0005615	0.944	extracellular space
GO:0030312	0.705	external encapsulating structure
GO:0062023	0.690	collagen-containing extracellular matrix
GO:0043227	0.626	membrane-bounded organelle
GO:0005622	0.555	intracellular anatomical structure
GO:0043231	0.397	intracellular membrane-bounded organelle
GO:0005604	0.372	basement membrane
GO:0016020	0.329	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]