StarFunc result for job id Q9H3W5

User Input

>input (708 residues)
MKDMPLRIHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEASTVDCNDLGL
LTFPARLPANTQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLS
VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN
SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES
ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL
KEISIHSNPIRCDCVIRWMNMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFRDMMEICL
PLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGT
LDINGVTPKEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIRDIQANSVLVS
WKASSKILKSSVKWTAFVKTENSHAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQ
KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLSPEMNCDGGHS
YVRNYLQKPTFALGELYPPLINLWEAGKEKSTSLKVKATVIGLPTNMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CBC6	0.917	0.919	0.000	707	0.879	0.880	Q8CBC6.pdb.gz	LRRN3_MOUSE Leucine-rich repeat neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrn3 PE=2 SV=1
2	AFDB:Q61809	0.732	0.724	4.127E-75	716	0.521	0.515	Q61809.pdb.gz	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
3	AFDB:A9JRH0	0.764	0.755	1.340E-73	717	0.508	0.502	A9JRH0.pdb.gz	A9JRH0_DANRE Leucine-rich repeat neuronal 1 OS=Danio rerio OX=7955 GN=lrrn1 PE=1 SV=1
4	AFDB:O75325	0.684	0.680	1.547E-70	713	0.463	0.460	O75325.pdb.gz	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
5	AFDB:Q9P244	0.241	0.227	4.079E-29	771	0.199	0.183	Q9P244.pdb.gz	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
6	AFDB:D4A1J9	0.235	0.233	6.707E-29	719	0.201	0.197	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
7	AFDB:D4ABX8	0.212	0.224	1.813E-28	636	0.189	0.211	D4ABX8.pdb.gz	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
8	AFDB:Q9ULH4	0.236	0.221	2.378E-28	789	0.195	0.175	Q9ULH4.pdb.gz	LRFN2_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRFN2 PE=1 SV=2
9	AFDB:Q9BTN0	0.252	0.275	6.428E-28	628	0.192	0.217	Q9BTN0.pdb.gz	LRFN3_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRFN3 PE=2 SV=1
10	AFDB:Q3URE9	0.488	0.562	2.178E-27	606	0.223	0.261	Q3URE9.pdb.gz	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
11	PDB:7wv3A	0.247	0.260	7.042E-11	668	0.145	0.154	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:3t6qA	0.196	0.220	3.584E-10	601	0.137	0.161	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:1xcdA	0.327	0.713	4.493E-10	305	0.121	0.282	1xcdA.pdb.gz
14	PDB:7tvfD	0.308	0.393	6.749E-10	515	0.114	0.157	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:5y31B	0.224	0.305	1.110E-9	511	0.089	0.123	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:7wrqA	0.397	0.487	1.909E-9	566	0.119	0.148	7wrqA.pdb.gz
17	PDB:6gffI	0.341	0.424	3.138E-9	551	0.124	0.160	6gffI.pdb.gz
18	PDB:2ft3F	0.280	0.585	6.468E-9	305	0.095	0.220	2ft3F.pdb.gz
19	PDB:3b2dA	0.337	0.390	1.914E-8	601	0.114	0.135	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:6hkwA	0.320	0.678	7.099E-8	306	0.093	0.216	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JRH0	0.0	739	717	0.516	0.509	A9JRH0_DANRE Leucine-rich repeat neuronal 1 OS=Danio rerio OX=7955 GN=lrrn1 PE=1 SV=1
2	O75325	0.0	650	713	0.446	0.443	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
3	Q61809	0.0	787	716	0.541	0.535	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
4	Q6UXK5	0.0	793	716	0.535	0.529	LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 OS=Homo sapiens OX=9606 GN=LRRN1 PE=1 SV=1
5	Q8CBC6	0.0	1265	707	0.879	0.880	LRRN3_MOUSE Leucine-rich repeat neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrn3 PE=2 SV=1
6	Q9ESY6	0.0	1251	707	0.874	0.876	LRRN3_RAT Leucine-rich repeat neuronal protein 3 OS=Rattus norvegicus OX=10116 GN=Lrrn3 PE=2 SV=1
7	Q3URE9	1.21e-41	162	606	0.202	0.236	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
8	Q96FE5	2.59e-40	159	620	0.181	0.206	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
9	Q9D1T0	2.87e-40	159	614	0.181	0.208	LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Lingo1 PE=1 SV=1
10	Q66HV9	9.03e-37	148	622	0.186	0.212	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
11	M9PFH7	1.60e-36	149	751	0.169	0.160	M9PFH7_DROME Tartan, isoform B OS=Drosophila melanogaster OX=7227 GN=trn PE=4 SV=1
12	Q24250	1.66e-36	149	733	0.169	0.164	Q24250_DROME Tartan protein OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
13	Q9VU51	2.04e-36	148	737	0.169	0.163	Q9VU51_DROME GH10871p OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
14	Q8C031	4.06e-33	137	640	0.186	0.206	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
15	Q149C3	9.54e-33	136	593	0.184	0.219	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
16	Q9VU53	1.15e-32	135	540	0.147	0.193	Q9VU53_DROME Capricious, isoform A OS=Drosophila melanogaster OX=7227 GN=caps PE=1 SV=3
17	Q9HCJ2	1.29e-32	136	640	0.185	0.205	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
18	O96671	1.46e-32	134	532	0.147	0.195	O96671_DROME CAPRICIOUS OS=Drosophila melanogaster OX=7227 GN=caps PE=2 SV=1
19	A0A0S0WP14	5.28e-32	135	811	0.147	0.128	A0A0S0WP14_DROME Capricious, isoform E OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=1
20	Q0E8F0	5.29e-32	135	780	0.147	0.133	Q0E8F0_DROME Capricious, isoform D OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.00074	31.1	Fibronectin type III domain
2	PF07679 I-set	9e-10	49.8	Immunoglobulin I-set domain
3	PF00047 ig	0.0041	28.6	Immunoglobulin domain
4	PF13895 Ig_2	0.048	25.3	Immunoglobulin domain
5	PF13927 Ig_3	1.3e-08	46.6	Immunoglobulin domain
6	PF01463 LRRCT	4.2	19.2	Leucine rich repeat C-terminal domain
7	PF01462 LRRNT	0.028	25.3	Leucine rich repeat N-terminal domain
8	PF00560 LRR_1	8.6e+02	12.0	Leucine Rich Repeat
9	PF12799 LRR_4	1.2e-16	71.7	Leucine Rich repeats (2 copies)
10	PF13306 LRR_5	7.6e-16	69.7	BspA type Leucine rich repeat region (6 copies)
11	PF13855 LRR_8	4.9e-36	133.6	Leucine rich repeat
12	PF14580 LRR_9	7e-07	40.5	Leucine-rich repeat
13	PF07686 V-set	2.9e+02	13.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397312

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384966	0.733	Mitochondrial inner membrane protease subunit 2
2	9606.ENSP00000404179	0.670	Dedicator of cytokinesis protein 4
3	9606.ENSP00000297135	0.645	Conserved oligomeric Golgi complex subunit 5
4	9606.ENSP00000303570	0.642	Ankyrin repeat and MYND domain-containing protein 2
5	9606.ENSP00000284311	0.564	G-protein coupled receptor 15
6	9606.ENSP00000352121	0.542	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
7	9606.ENSP00000369531	0.542	Ubiquilin-like protein
8	9606.ENSP00000368314	0.532	Neuronal cell adhesion molecule
9	9606.ENSP00000386607	0.520	V-set and transmembrane domain-containing protein 5
10	9606.ENSP00000356437	0.517	SAM and SH3 domain-containing protein 1
11	9606.ENSP00000421226	0.517	Claudin domain containing 1
12	9606.ENSP00000463650	0.513	E3 ubiquitin-protein ligase RNF115
13	9606.ENSP00000343847	0.505	Serine/threonine-protein kinase Nek10
14	9606.ENSP00000263256	0.504	Desumoylating isopeptidase 1
15	9606.ENSP00000248076	0.502	Proteinase-activated receptor 4
16	9606.ENSP00000334642	0.500	PDZ domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.807	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.933	positive regulation of biological process
GO:0048522	0.884	positive regulation of cellular process
GO:0060255	0.839	regulation of macromolecule metabolic process
GO:0080090	0.834	regulation of primary metabolic process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0009987	0.825	cellular process
GO:0031323	0.808	regulation of cellular metabolic process
GO:0051174	0.765	regulation of phosphorus metabolic process
GO:0051246	0.749	regulation of protein metabolic process
GO:0065008	0.634	regulation of biological quality
GO:0031399	0.603	regulation of protein modification process
GO:0051239	0.584	regulation of multicellular organismal process
GO:0009893	0.507	positive regulation of metabolic process
GO:0019220	0.476	regulation of phosphate metabolic process
GO:0051128	0.338	regulation of cellular component organization
GO:0010604	0.320	positive regulation of macromolecule metabolic process
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005737	0.976	cytoplasm
GO:0032991	0.916	protein-containing complex
GO:0043231	0.711	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]