StarFunc result for job id Q9H3Z4

User Input

>input (198 residues)
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60904	0.794	0.794	2.438E-27	198	0.995	0.995	P60904.pdb.gz	DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus OX=10090 GN=Dnajc5 PE=1 SV=1
2	AFDB:Q9UF47	0.630	0.627	1.371E-18	199	0.667	0.663	Q9UF47.pdb.gz	DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens OX=9606 GN=DNAJC5B PE=1 SV=2
3	AFDB:Q03751	0.624	0.500	8.820E-15	249	0.510	0.406	Q03751.pdb.gz	DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster OX=7227 GN=Csp PE=1 SV=1
4	AFDB:E5QCE7	0.384	0.351	1.001E-9	217	0.369	0.336	E5QCE7.pdb.gz	E5QCE7_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-14 PE=1 SV=1
5	AFDB:B9FHF3	0.407	0.236	6.149E-7	347	0.242	0.138	B9FHF3.pdb.gz	DJB6_ORYSJ DnaJ protein ERDJ3B OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ3B PE=1 SV=1
6	AFDB:Q9LZK5	0.399	0.229	8.410E-7	346	0.222	0.127	Q9LZK5.pdb.gz	DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=ERDJ3B PE=1 SV=1
7	AFDB:Q9VGR0	0.344	0.232	3.101E-6	299	0.232	0.154	Q9VGR0.pdb.gz	Q9VGR0_DROME RE47242p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17187 PE=1 SV=2
8	AFDB:E9PH18	0.353	0.332	3.627E-6	211	0.283	0.265	E9PH18.pdb.gz	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
9	AFDB:Q9UBS3	0.361	0.323	4.469E-6	223	0.217	0.193	Q9UBS3.pdb.gz	DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens OX=9606 GN=DNAJB9 PE=1 SV=1
10	AFDB:P53940	0.357	0.141	5.226E-6	528	0.247	0.093	P53940.pdb.gz	APJ1_YEAST J domain-containing protein APJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APJ1 PE=1 SV=1
11	PDB:6byrA	0.325	0.163	6.088E-4	405	0.177	0.086	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.324	0.249	3.235E-3	262	0.141	0.107	7x3kA.pdb.gz
13	PDB:5y88T	0.245	0.417	5.144E-2	107	0.167	0.308	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:1fpoA	0.278	0.319	2.105E-1	171	0.076	0.088	1fpoA.pdb.gz
15	PDB:7d5sA5	0.137	0.070	1.698	514	0.106	0.041	7d5sA5.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:4xnhA	0.174	0.052	3.178	786	0.081	0.020	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
17	PDB:5apnh	0.186	0.271	3.178	119	0.071	0.118	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:4zs7A	0.157	0.205	3.527	139	0.040	0.058	4zs7A.pdb.gz
19	PDB:6tz402	0.180	0.199	3.915	176	0.101	0.114	6tz402.pdb.gz
20	PDB:3rqsB	0.140	0.098	4.125	316	0.086	0.054	3rqsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H3Z4	2.79e-149	414	198	1.000	1.000	DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1
2	Q29455	1.97e-148	411	198	0.990	0.990	DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus OX=9913 GN=DNAJC5 PE=1 SV=1
3	P60904	2.19e-148	411	198	0.995	0.995	DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus OX=10090 GN=Dnajc5 PE=1 SV=1
4	P60905	2.19e-148	411	198	0.995	0.995	DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Dnajc5 PE=1 SV=1
5	Q8TET0	1.58e-104	298	142	0.717	1.000	Q8TET0_HUMAN FLJ00095 protein (Fragment) OS=Homo sapiens OX=9606 GN=FLJ00095 PE=2 SV=1
6	Q6AHX3	1.47e-100	288	137	0.692	1.000	Q6AHX3_HUMAN Uncharacterized protein DKFZp761N1221 (Fragment) OS=Homo sapiens OX=9606 GN=DKFZp761N1221 PE=2 SV=1
7	Q9UF47	2.78e-82	244	199	0.672	0.668	DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens OX=9606 GN=DNAJC5B PE=1 SV=2
8	Q03751	9.00e-57	181	249	0.510	0.406	DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster OX=7227 GN=Csp PE=1 SV=1
9	E5QCE7	4.35e-29	109	217	0.293	0.267	E5QCE7_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-14 PE=1 SV=1
10	B9FHF3	8.87e-25	100	347	0.237	0.135	DJB6_ORYSJ DnaJ protein ERDJ3B OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ3B PE=1 SV=1
11	Q6DHR2	6.37e-23	95.5	316	0.217	0.136	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
12	Q7ZW83	1.41e-22	93.2	237	0.217	0.181	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
13	Q38C15	2.40e-21	92.4	416	0.207	0.099	Q38C15_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5440 PE=3 SV=1
14	Q9LZK5	3.67e-21	91.3	346	0.217	0.124	DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=ERDJ3B PE=1 SV=1
15	O54946	7.36e-21	90.5	365	0.207	0.112	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
16	C9J2C4	1.01e-20	87.8	228	0.197	0.171	C9J2C4_HUMAN DnaJ heat shock protein family (Hsp40) member B6 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
17	Q24133	1.62e-20	89.4	334	0.202	0.120	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
18	C9JRD2	1.87e-20	87.0	228	0.197	0.171	C9JRD2_HUMAN DnaJ heat shock protein family (Hsp40) member B2 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=1
19	E9PH18	3.70e-20	85.9	211	0.197	0.185	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
20	A0A0J9YX62	4.85e-20	87.8	334	0.197	0.117	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12259 Baculo_F	45	14.0	Baculovirus F protein
2	PF00226 DnaJ	4.4e-24	95.7	DnaJ domain
3	PF02990 EMP70	1.1e+02	12.9	Endomembrane protein 70

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005410000.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005378436.1	0.946	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 133 mRNAs, 3 ESTs, 73 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
2	34839.XP_005387321.1	0.872	Heat shock 70 kDa protein 14
3	34839.XP_005390164.1	0.871	Heat shock 70 kDa protein 1B-like
4	34839.XP_005380929.1	0.846	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
5	34839.XP_005389446.1	0.841	Heat shock 70 kDa protein 1-like
6	34839.XP_005376179.1	0.840	Heat shock 70 kDa protein 4
7	34839.XP_005399177.1	0.828	Heat shock-related 70 kDa protein 2
8	34839.XP_005396205.1	0.796	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
9	34839.XP_005399488.1	0.788	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 21 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
10	34839.XP_005382153.1	0.772	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 30 mRNAs, 28 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
11	34839.XP_005392588.1	0.772	Vesicular inhibitory amino acid transporter
12	34839.XP_005389878.1	0.760	Cell division cycle 5-like protein
13	34839.XP_005374413.1	0.754	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	34839.XP_005382523.1	0.743	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 78 mRNAs, 35 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
15	34839.XP_005375620.1	0.742	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	34839.XP_005381003.1	0.731	Crooked neck-like protein 1
17	34839.XP_005398365.1	0.728	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
18	34839.XP_005409619.1	0.725	Ras-related protein Rab-3A
19	34839.XP_005386321.1	0.720	dnaJ homolog subfamily C member 21
20	34839.XP_005374307.1	0.707	Alpha-synuclein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.988	biological regulation
GO:0007267	0.986	cell-cell signaling
GO:0099537	0.984	trans-synaptic signaling
GO:0007268	0.960	chemical synaptic transmission
GO:0050789	0.899	regulation of biological process
GO:0050794	0.889	regulation of cellular process
GO:0140352	0.849	export from cell
GO:0007269	0.841	neurotransmitter secretion
GO:0099003	0.825	vesicle-mediated transport in synapse
GO:0099504	0.692	synaptic vesicle cycle
GO:0006887	0.632	exocytosis
GO:0045055	0.614	regulated exocytosis
GO:0016079	0.539	synaptic vesicle exocytosis
GO:0048519	0.436	negative regulation of biological process
GO:0051049	0.386	regulation of transport
GO:0048523	0.354	negative regulation of cellular process
GO:0050896	0.332	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0099503	0.997	secretory vesicle
GO:0005829	0.995	cytosol
GO:0098588	0.995	bounding membrane of organelle
GO:0005886	0.981	plasma membrane
GO:0030659	0.981	cytoplasmic vesicle membrane
GO:0030054	0.980	cell junction
GO:0098793	0.955	presynapse
GO:0030133	0.946	transport vesicle
GO:0030136	0.922	clathrin-coated vesicle
GO:0008021	0.910	synaptic vesicle
GO:0060198	0.900	clathrin-sculpted vesicle
GO:0030662	0.873	coated vesicle membrane
GO:0030658	0.871	transport vesicle membrane
GO:0030665	0.862	clathrin-coated vesicle membrane
GO:0005773	0.489	vacuole
GO:0000323	0.394	lytic vacuole
GO:0120025	0.380	plasma membrane bounded cell projection
GO:0005774	0.378	vacuolar membrane
GO:0098852	0.372	lytic vacuole membrane
GO:0043005	0.363	neuron projection
GO:0005764	0.363	lysosome
GO:0005765	0.344	lysosomal membrane
GO:0065010	0.317	extracellular membrane-bounded organelle
GO:0030141	0.302	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]