StarFunc result for job id Q9H400

User Input

>input (295 residues)
MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEA
SLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAF
PHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSP
QEPQQGKTEVTPAAQVDVLYSRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPL
RALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSCPSLGRGWRPLPASLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H400	0.999	0.999	4.020E-43	295	1.000	1.000	Q9H400.pdb.gz	LIME1_HUMAN Lck-interacting transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LIME1 PE=1 SV=1
2	AFDB:A3KMN5	0.090	0.088	2.433E-1	304	0.173	0.168	A3KMN5.pdb.gz	LARGN_MOUSE Protein Largen OS=Mus musculus OX=10090 GN=Prr16 PE=2 SV=1
3	AFDB:Q9Y5G9	0.093	0.038	4.536E-1	962	0.139	0.043	Q9Y5G9.pdb.gz	PCDG4_HUMAN Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2
4	AFDB:Q9JHX3	0.087	0.058	5.583E-1	529	0.186	0.104	Q9JHX3.pdb.gz	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
5	AFDB:Q91XZ0	0.082	0.033	7.363E-1	931	0.149	0.047	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
6	AFDB:A8WH80	0.119	0.045	1.471	1091	0.112	0.030	A8WH80.pdb.gz
7	AFDB:A0A024R214	0.097	0.057	1.577	626	0.169	0.080	A0A024R214.pdb.gz	A0A024R214_HUMAN Cytoplasmic polyadenylation element binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
8	AFDB:Q3U4B1	0.076	0.066	1.811	363	0.156	0.127	Q3U4B1.pdb.gz	Q3U4B1_MOUSE Single stranded DNA binding protein 4 OS=Mus musculus OX=10090 GN=Ssbp4 PE=1 SV=1
9	AFDB:P47046	0.092	0.046	1.940	822	0.132	0.047	P47046.pdb.gz	IRC8_YEAST Uncharacterized protein IRC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC8 PE=1 SV=1
10	AFDB:Q2TJI7	0.083	0.075	2.079	331	0.142	0.127	Q2TJI7.pdb.gz	Q2TJI7_MOUSE Protocadherin 1 isoform 2b (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=2 SV=1
11	PDB:6lss4	0.100	0.053	8.626	620	0.051	0.024	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H400	0.0	578	295	1.000	1.000	LIME1_HUMAN Lck-interacting transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LIME1 PE=1 SV=1
2	Q9EQR5	6.81e-89	268	269	0.559	0.613	LIME1_MOUSE Lck-interacting transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lime1 PE=1 SV=1
3	Q9US38	0.74	33.5	341	0.061	0.053	YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.03 PE=3 SV=1
4	P77243	3.4	31.6	483	0.071	0.043	PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=prpD PE=1 SV=3
5	O74919	7.7	30.4	398	0.058	0.043	RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10724 DUF2516	2.5e+02	13.3	Protein of unknown function (DUF2516)
2	PF14316 DUF4381	1.8	20.3	Domain of unknown function (DUF4381)
3	PF15332 LIME1	3.1e-110	378.7	Lck-interacting transmembrane adapter 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309521

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337825	0.758	Tyrosine-protein kinase Lck
2	9606.ENSP00000266077	0.692	SLC2A4 regulator
3	9606.ENSP00000332013	0.668	Zinc finger CCCH-type with G patch domain-containing protein
4	9606.ENSP00000426906	0.601	Belongs to the RNase T2 family.
5	9606.ENSP00000221972	0.557	B-cell antigen receptor complex-associated protein alpha chain
6	9606.ENSP00000376544	0.556	B-cell antigen receptor complex-associated protein beta chain
7	9606.ENSP00000376345	0.541	Growth factor receptor-bound protein 2
8	9606.ENSP00000254801	0.540	Immunoglobulin J chain
9	9606.ENSP00000329312	0.540	Immunoglobulin lambda-like polypeptide 1
10	9606.ENSP00000431254	0.540	Immunoglobulin lambda like polypeptide 5
11	9606.ENSP00000478289	0.540	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
12	9606.ENSP00000478725	0.540	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
13	9606.ENSP00000479675	0.540	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
14	9606.ENSP00000481152	0.540	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
15	9606.ENSP00000467931	0.519	Zinc finger protein 461

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0051716	0.991	cellular response to stimulus
GO:0048583	0.985	regulation of response to stimulus
GO:0002682	0.985	regulation of immune system process
GO:0007165	0.971	signal transduction
GO:0019222	0.931	regulation of metabolic process
GO:0007166	0.924	cell surface receptor signaling pathway
GO:0048518	0.923	positive regulation of biological process
GO:0002376	0.921	immune system process
GO:0050776	0.894	regulation of immune response
GO:0002429	0.873	immune response-activating cell surface receptor signaling pathway
GO:0050851	0.860	antigen receptor-mediated signaling pathway
GO:0009966	0.841	regulation of signal transduction
GO:0080090	0.823	regulation of primary metabolic process
GO:0051171	0.823	regulation of nitrogen compound metabolic process
GO:0060255	0.822	regulation of macromolecule metabolic process
GO:0031323	0.822	regulation of cellular metabolic process
GO:0050853	0.757	B cell receptor signaling pathway
GO:1902531	0.636	regulation of intracellular signal transduction
GO:0065009	0.605	regulation of molecular function
GO:0050790	0.586	regulation of catalytic activity
GO:0051246	0.534	regulation of protein metabolic process
GO:0034762	0.498	regulation of transmembrane transport
GO:0031399	0.482	regulation of protein modification process
GO:0051174	0.476	regulation of phosphorus metabolic process
GO:0019220	0.471	regulation of phosphate metabolic process
GO:0042325	0.464	regulation of phosphorylation
GO:0001932	0.439	regulation of protein phosphorylation
GO:0010556	0.415	regulation of macromolecule biosynthetic process
GO:0051338	0.413	regulation of transferase activity
GO:0043549	0.403	regulation of kinase activity
GO:0006357	0.388	regulation of transcription by RNA polymerase II
GO:0045859	0.388	regulation of protein kinase activity
GO:1903169	0.357	regulation of calcium ion transmembrane transport
GO:0043122	0.344	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0071900	0.300	regulation of protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043227	0.953	membrane-bounded organelle
GO:0016020	0.949	membrane
GO:0005886	0.938	plasma membrane
GO:0005622	0.757	intracellular anatomical structure
GO:0031982	0.714	vesicle
GO:0070062	0.701	extracellular exosome
GO:0043229	0.682	intracellular organelle
GO:0005737	0.484	cytoplasm
GO:0043231	0.430	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]