StarFunc result for job id Q9H426

User Input

>input (269 residues)
MERSQSRLSLSASFEALAIYFPCMNSFDDEDAGDSRRLKGAIQRSTETGLAVEMPSRTLR
QASHESIEDSMNSYGSEGNLNYGGVCLASDAQFSDFLGSMGPAQFVGRQTLATTPMGDVE
IGLQERNGQLEVDIIQARGLTAKPGSKTLPAAYIKAYLLENGICIAKKKTKVARKSLDPL
YNQVLLFPESPQGKVLQVIVWGNYGRMERKQFMGVARVLLEELDLTTLAVGWYKLFPTSS
MVDPATGPLLRQASQLSLESTVGPCGERS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60191	0.787	0.787	3.119E-46	269	0.993	0.993	P60191.pdb.gz	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
2	AFDB:Q99NE5	0.571	0.110	8.824E-32	1463	0.595	0.109	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
3	AFDB:Q9EQZ7	0.599	0.111	7.110E-31	1530	0.602	0.106	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
4	AFDB:Q9JIS1	0.571	0.101	8.384E-31	1555	0.595	0.103	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
5	AFDB:Q86UR5	0.571	0.094	1.166E-30	1692	0.595	0.095	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
6	AFDB:Q9JIR4	0.566	0.101	1.534E-30	1615	0.595	0.099	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
7	AFDB:Q9UJD0	0.573	0.501	1.620E-30	308	0.546	0.477	Q9UJD0.pdb.gz	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
8	AFDB:Q9UQ26	0.569	0.112	2.514E-30	1411	0.572	0.109	Q9UQ26.pdb.gz	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
9	AFDB:Q22366	0.557	0.100	3.226E-22	1563	0.342	0.059	Q22366.pdb.gz	RIM_CAEEL Rab-3-interacting molecule unc-10 OS=Caenorhabditis elegans OX=6239 GN=unc-10 PE=2 SV=2
10	AFDB:M9PE32	0.485	0.105	5.732E-15	1314	0.216	0.044	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
11	PDB:3pfqA	0.402	0.216	2.558E-8	523	0.126	0.065	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:1cjyA	0.297	0.133	3.061E-4	633	0.063	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5izrC	0.299	0.130	3.609E-4	659	0.082	0.033	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5a52A	0.259	0.436	5.600E-4	154	0.074	0.130	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5ixcA	0.308	0.128	7.785E-4	684	0.078	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5a50A	0.287	0.457	1.208E-3	165	0.063	0.103	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:3nsjA	0.246	0.133	1.348E-3	530	0.071	0.036	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
18	PDB:4gnkB	0.274	0.103	1.679E-3	769	0.078	0.027	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
19	PDB:4rj9A	0.254	0.409	1.980E-3	161	0.067	0.112	4rj9A.pdb.gz
20	PDB:7lq1A	0.265	0.080	2.210E-3	950	0.056	0.016	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60191	0.0	551	269	0.993	0.993	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
2	Q8CIX1	0.0	548	269	0.989	0.989	RIMS4_RAT Regulating synaptic membrane exocytosis protein 4 OS=Rattus norvegicus OX=10116 GN=Rims4 PE=1 SV=1
3	Q9H426	0.0	553	269	1.000	1.000	RIMS4_HUMAN Regulating synaptic membrane exocytosis protein 4 OS=Homo sapiens OX=9606 GN=RIMS4 PE=1 SV=3
4	Q9UQ26	1.24e-105	336	1411	0.591	0.113	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
5	Q9JIS1	3.82e-105	335	1555	0.584	0.101	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	Q9EQZ7	9.50e-105	334	1530	0.580	0.102	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
7	Q86UR5	2.35e-102	328	1692	0.599	0.095	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
8	Q9JIR4	2.55e-97	314	1615	0.595	0.099	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
9	Q99NE5	4.14e-97	313	1463	0.595	0.109	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
10	Q9UJD0	1.54e-95	285	308	0.532	0.464	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
11	Q80U57	4.44e-94	281	307	0.546	0.479	RIMS3_MOUSE Regulating synaptic membrane exocytosis protein 3 OS=Mus musculus OX=10090 GN=Rims3 PE=1 SV=2
12	Q9JIR3	6.57e-94	281	307	0.543	0.476	RIMS3_RAT Regulating synaptic membrane exocytosis protein 3 OS=Rattus norvegicus OX=10116 GN=Rims3 PE=1 SV=1
13	A0A0B4K742	1.37e-48	174	2595	0.309	0.032	A0A0B4K742_DROME Rab3 interacting molecule, isoform W OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
14	A0A0B4K6B7	1.52e-48	174	1655	0.309	0.050	A0A0B4K6B7_DROME Rab3 interacting molecule, isoform Z OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
15	A0A0B4K7E1	1.66e-48	174	1955	0.309	0.042	A0A0B4K7E1_DROME Rab3 interacting molecule, isoform U OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
16	A0A0B4K679	1.94e-48	174	1965	0.309	0.042	A0A0B4K679_DROME Rab3 interacting molecule, isoform V OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
17	A0A0B4K6M2	2.21e-48	174	2798	0.309	0.030	A0A0B4K6M2_DROME Rab3 interacting molecule, isoform F OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
18	A0A0B4K6B1	1.01e-47	172	2792	0.283	0.027	A0A0B4K6B1_DROME Rab3 interacting molecule, isoform P OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
19	A0A0B4K7F3	1.44e-47	171	1399	0.279	0.054	A0A0B4K7F3_DROME Rab3 interacting molecule, isoform S OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
20	Q9VEE5	1.47e-47	171	1931	0.279	0.039	Q9VEE5_DROME Rab3 interacting molecule, isoform Q OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	7.1e-12	56.9	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010338

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001815	0.695	Unc-13 homolog A (C. elegans)
2	60711.ENSCSAP00000006559	0.695	Unc-13 homolog B (C. elegans)
3	60711.ENSCSAP00000007780	0.695	Uncharacterized protein
4	60711.ENSCSAP00000000640	0.673	PIGY upstream reading frame
5	60711.ENSCSAP00000011241	0.673	Prenylcysteine oxidase 1
6	60711.ENSCSAP00000016405	0.658	Zinc finger protein 154
7	60711.ENSCSAP00000014078	0.630	Synaptotagmin-like 5
8	60711.ENSCSAP00000002024	0.617	TSPO associated protein 1
9	60711.ENSCSAP00000016119	0.617	RIMS binding protein 2
10	60711.ENSCSAP00000018780	0.617	annotation not available
11	60711.ENSCSAP00000001693	0.607	RAB3A, member RAS oncogene family
12	60711.ENSCSAP00000012215	0.607	RAB3C, member RAS oncogene family
13	60711.ENSCSAP00000007242	0.606	Unc-79 homolog, NALCN channel complex subunit
14	60711.ENSCSAP00000014257	0.583	annotation not available
15	60711.ENSCSAP00000003109	0.573	RAB3D, member RAS oncogene family
16	60711.ENSCSAP00000016746	0.573	RAB3B, member RAS oncogene family
17	60711.ENSCSAP00000000734	0.558	Synaptotagmin IX
18	60711.ENSCSAP00000011439	0.546	Complexin 1
19	60711.ENSCSAP00000011927	0.540	RAB3 GTPase activating protein subunit 2 (non-catalytic)
20	60711.ENSCSAP00000010839	0.531	ALK and LTK ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044325	0.702	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.985	regulation of cellular process
GO:0065008	0.959	regulation of biological quality
GO:0051049	0.958	regulation of transport
GO:0001505	0.954	regulation of neurotransmitter levels
GO:0099177	0.954	regulation of trans-synaptic signaling
GO:0050804	0.930	modulation of chemical synaptic transmission
GO:0051588	0.913	regulation of neurotransmitter transport
GO:0051046	0.897	regulation of secretion
GO:1903530	0.861	regulation of secretion by cell
GO:0060627	0.785	regulation of vesicle-mediated transport
GO:0009987	0.707	cellular process
GO:0046928	0.653	regulation of neurotransmitter secretion
GO:0051128	0.545	regulation of cellular component organization
GO:0017157	0.406	regulation of exocytosis
GO:0051234	0.369	establishment of localization
GO:0006810	0.353	transport
GO:1903305	0.342	regulation of regulated secretory pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.999	synapse
GO:0098793	0.912	presynapse
GO:0016020	0.877	membrane
GO:0005622	0.843	intracellular anatomical structure
GO:0071944	0.772	cell periphery
GO:0005737	0.737	cytoplasm
GO:0098978	0.717	glutamatergic synapse
GO:0043226	0.599	organelle
GO:0005886	0.533	plasma membrane
GO:0098590	0.337	plasma membrane region
GO:0097060	0.305	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]