StarFunc result for job id Q9H446

User Input

>input (243 residues)
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKY
PDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKT
RREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNK
LSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESD
SAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQK7	0.893	0.893	1.191E-39	243	0.963	0.963	Q9CQK7.pdb.gz	RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rwdd1 PE=1 SV=1
2	AFDB:Q9C8I1	0.447	0.432	1.496E-12	252	0.309	0.298	Q9C8I1.pdb.gz	Q9C8I1_ARATH Ubiquitin-conjugating enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g51730 PE=1 SV=1
3	AFDB:Q03768	0.582	0.537	1.215E-11	265	0.276	0.253	Q03768.pdb.gz	GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIR2 PE=1 SV=1
4	AFDB:O94721	0.495	0.552	9.869E-11	215	0.267	0.302	O94721.pdb.gz	YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1393.09c PE=4 SV=1
5	AFDB:Q5AGV1	0.579	0.545	1.101E-9	259	0.280	0.263	Q5AGV1.pdb.gz	Q5AGV1_CANAL Gir2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIR2 PE=4 SV=1
6	AFDB:D4A7V9	0.436	0.067	3.678E-9	1649	0.210	0.031	D4A7V9.pdb.gz	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
7	AFDB:P15442	0.427	0.068	4.176E-9	1659	0.214	0.031	P15442.pdb.gz	GCN2_YEAST eIF-2-alpha kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN2 PE=1 SV=3
8	AFDB:A0A1D8PQT9	0.493	0.075	4.741E-9	1764	0.185	0.026	A0A1D8PQT9.pdb.gz	A0A1D8PQT9_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCN2 PE=4 SV=1
9	AFDB:A1Z9I6	0.400	0.264	1.229E-8	374	0.111	0.072	A1Z9I6.pdb.gz	A1Z9I6_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=anon-EST:GressD1 PE=1 SV=1
10	AFDB:Q4GZ97	0.450	0.480	1.395E-8	227	0.251	0.269	Q4GZ97.pdb.gz	Q4GZ97_TRYB2 RWD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1220 PE=4 SV=1
11	PDB:2mt6A	0.252	0.383	1.306E-2	151	0.070	0.113	2mt6A.pdb.gz
12	PDB:1i7kA	0.318	0.488	1.911E-2	146	0.099	0.164	1i7kA.pdb.gz
13	PDB:6zhtB	0.225	0.339	2.981E-2	153	0.070	0.111	6zhtB.pdb.gz
14	PDB:6bqiA	0.282	0.267	5.624E-2	258	0.107	0.101	6bqiA.pdb.gz
15	PDB:7meyB	0.303	0.458	7.724E-2	153	0.070	0.111	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
16	PDB:6qleO	0.277	0.316	9.957E-2	205	0.086	0.102	6qleO.pdb.gz
17	PDB:2hlwA	0.189	0.251	1.457E-1	170	0.053	0.076	2hlwA.pdb.gz
18	PDB:4v60A	0.207	0.078	1.763E-1	812	0.165	0.049	4v60A.pdb.gz
19	PDB:6op8A	0.231	0.322	1.763E-1	167	0.045	0.066	6op8A.pdb.gz
20	PDB:7kzpL	0.205	0.141	1.763E-1	370	0.045	0.030	7kzpL.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H446	3.79e-176	485	243	1.000	1.000	RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RWDD1 PE=1 SV=1
2	Q9CQK7	2.63e-156	435	243	0.963	0.963	RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rwdd1 PE=1 SV=1
3	Q9C8I1	7.77e-27	105	252	0.313	0.302	Q9C8I1_ARATH Ubiquitin-conjugating enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g51730 PE=1 SV=1
4	O94721	1.08e-22	94.0	215	0.259	0.293	YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1393.09c PE=4 SV=1
5	Q03768	1.20e-18	84.3	265	0.296	0.272	GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIR2 PE=1 SV=1
6	Q5AGV1	2.63e-12	66.6	259	0.259	0.243	Q5AGV1_CANAL Gir2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIR2 PE=4 SV=1
7	D4A7V9	1.47e-06	51.2	1649	0.185	0.027	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
8	P15442	2.22e-06	50.4	1659	0.189	0.028	GCN2_YEAST eIF-2-alpha kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN2 PE=1 SV=3
9	Q9P2K8	2.43e-06	50.4	1649	0.181	0.027	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
10	Q4GZ97	2.90e-06	48.9	227	0.247	0.264	Q4GZ97_TRYB2 RWD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1220 PE=4 SV=1
11	Q9QZ05	3.90e-06	49.7	1648	0.185	0.027	E2AK4_MOUSE eIF-2-alpha kinase GCN2 OS=Mus musculus OX=10090 GN=Eif2ak4 PE=1 SV=2
12	Q96BH1	6.37e-06	48.9	459	0.148	0.078	RNF25_HUMAN E3 ubiquitin-protein ligase RNF25 OS=Homo sapiens OX=9606 GN=RNF25 PE=1 SV=1
13	Q9HGN1	1.11e-05	48.5	1576	0.169	0.026	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
14	F4J8A5	2.67e-05	47.4	1265	0.132	0.025	F4J8A5_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=GCN2 PE=1 SV=1
15	Q9QZR0	3.61e-05	46.6	456	0.148	0.079	RNF25_MOUSE E3 ubiquitin-protein ligase RNF25 OS=Mus musculus OX=10090 GN=Rnf25 PE=1 SV=2
16	Q6NW29	7.00e-05	44.7	188	0.160	0.207	RWDD4_HUMAN RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3
17	Q7SXJ6	1.14e-04	45.1	513	0.111	0.053	RNF25_DANRE E3 ubiquitin-protein ligase RNF25 OS=Danio rerio OX=7955 GN=rnf25 PE=1 SV=2
18	A1Z9I6	8.21e-04	42.4	374	0.123	0.080	A1Z9I6_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=anon-EST:GressD1 PE=1 SV=1
19	Q4WU06	0.002	41.6	1592	0.136	0.021	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
20	O13997	0.005	39.7	280	0.181	0.157	YIH1_SCHPO Protein IMPACT homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yih1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08326 ACC_central	34	14.2	Acetyl-CoA carboxylase, central region
2	PF09073 BUD22	9.9e+02	10.4	BUD22
3	PF16543 DFRP_C	0.013	27.3	DRG Family Regulatory Proteins, Tma46
4	PF11704 Folliculin	2.2e+02	13.1	Vesicle coat protein involved in Golgi to plasma membrane transport
5	PF00644 PARP	4.2e+02	11.9	Poly(ADP-ribose) polymerase catalytic domain
6	PF05773 RWD	4.4e-23	93.2	RWD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011852

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004584	0.978	Developmentally regulated GTP binding protein 2
2	60711.ENSCSAP00000004985	0.952	Developmentally regulated GTP binding protein 1
3	60711.ENSCSAP00000015762	0.867	GCN1, eIF2 alpha kinase activator homolog
4	60711.ENSCSAP00000008738	0.710	Zinc finger CCCH-type containing 15
5	60711.ENSCSAP00000016837	0.703	EBNA1 binding protein 2
6	60711.ENSCSAP00000001812	0.687	Prefoldin subunit 5
7	60711.ENSCSAP00000003371	0.678	KRI1 homolog (S. cerevisiae)
8	60711.ENSCSAP00000015016	0.673	RWD domain containing 4
9	60711.ENSCSAP00000008757	0.640	Alpha-1-microglobulin/bikunin precursor
10	60711.ENSCSAP00000012346	0.615	Ly1 antibody reactive
11	60711.ENSCSAP00000013814	0.572	Impact RWD domain protein
12	60711.ENSCSAP00000016281	0.563	HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
13	60711.ENSCSAP00000012355	0.558	Clavesin 2
14	60711.ENSCSAP00000014516	0.545	Coiled-coil domain containing 97
15	60711.ENSCSAP00000003686	0.542	Uncharacterized protein
16	60711.ENSCSAP00000000344	0.541	Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
17	60711.ENSCSAP00000010354	0.541	annotation not available
18	60711.ENSCSAP00000017729	0.541	annotation not available
19	60711.ENSCSAP00000006314	0.534	RNA binding motif protein 34
20	60711.ENSCSAP00000014664	0.531	Zinc finger protein 428

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0044093	0.988	positive regulation of molecular function
GO:0009966	0.977	regulation of signal transduction
GO:0071407	0.976	cellular response to organic cyclic compound
GO:0007154	0.974	cell communication
GO:0023052	0.972	signaling
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0071495	0.968	cellular response to endogenous stimulus
GO:0007165	0.964	signal transduction
GO:0080090	0.958	regulation of primary metabolic process
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0048545	0.946	response to steroid hormone
GO:0009755	0.945	hormone-mediated signaling pathway
GO:0030518	0.935	intracellular steroid hormone receptor signaling pathway
GO:0031323	0.858	regulation of cellular metabolic process
GO:1901700	0.825	response to oxygen-containing compound
GO:0010556	0.803	regulation of macromolecule biosynthetic process
GO:1901654	0.802	response to ketone
GO:0010469	0.790	regulation of signaling receptor activity
GO:2000273	0.767	positive regulation of signaling receptor activity
GO:1901701	0.743	cellular response to oxygen-containing compound
GO:0031326	0.658	regulation of cellular biosynthetic process
GO:0010468	0.651	regulation of gene expression
GO:0019219	0.651	regulation of nucleobase-containing compound metabolic process
GO:0051091	0.634	positive regulation of DNA-binding transcription factor activity
GO:0062197	0.626	cellular response to chemical stress
GO:0006979	0.602	response to oxidative stress
GO:1901655	0.462	cellular response to ketone
GO:0006357	0.460	regulation of transcription by RNA polymerase II
GO:0034599	0.456	cellular response to oxidative stress
GO:0033574	0.312	response to testosterone
GO:0008152	0.305	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.942	cytosol
GO:0043226	0.937	organelle
GO:0043229	0.926	intracellular organelle
GO:0043227	0.821	membrane-bounded organelle
GO:0005634	0.810	nucleus
GO:0031981	0.596	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]