StarFunc result for job id Q9H4A3

User Input

>input (2382 residues)
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQG
QPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAP
QVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLL
QPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNI
APSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPG
GSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQPTTLASSVDSAHSDVASGMS
DGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETH
NRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEP
EGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV
SPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPN
TAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTE
EGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEI
VVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPS
TASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSY
ISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHS
QPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVST
TTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQL
RRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRF
QVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSD
VPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPP
FMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKS
LPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASV
LHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTN
TVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPG
MARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGT
GGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q6T6	0.244	0.246	0.000	2357	0.456	0.461	F1Q6T6.pdb.gz
2	AFDB:P83741	0.266	0.267	0.000	2377	0.855	0.857	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
3	AFDB:Q9H4A3	1.000	1.000	0.000	2382	1.000	1.000	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
4	AFDB:Q9JIH7	0.245	0.270	0.000	2126	0.772	0.865	Q9JIH7.pdb.gz	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
5	AFDB:E7F2F9	0.186	0.264	2.747E-97	1634	0.362	0.528	E7F2F9.pdb.gz	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
6	AFDB:Q9Y3S1	0.166	0.171	1.611E-93	2297	0.342	0.354	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
7	AFDB:Q3UH66	0.162	0.178	2.939E-91	2149	0.339	0.376	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
8	AFDB:Q9BYP7	0.162	0.210	6.670E-76	1800	0.294	0.389	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
9	AFDB:Q80XP9	0.160	0.212	7.041E-76	1757	0.288	0.391	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
10	AFDB:M9PGC5	0.165	0.160	1.307E-65	2462	0.235	0.227	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
11	PDB:5u6yA	0.102	0.495	2.594E-17	459	0.027	0.142	5u6yA.pdb.gz
12	PDB:2yaaA	0.105	0.763	4.226E-17	300	0.029	0.227	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
13	PDB:4krcA	0.100	0.713	5.851E-17	297	0.034	0.269	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	PDB:4rerA	0.103	0.496	6.885E-17	459	0.027	0.142	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4eomC	0.100	0.755	7.674E-17	276	0.031	0.264	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:5ufuA	0.102	0.598	8.101E-17	369	0.029	0.184	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:6s73A	0.098	0.781	1.062E-16	269	0.029	0.260	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:6byrA	0.102	0.560	1.640E-16	405	0.030	0.178	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
19	PDB:3c4wB	0.101	0.434	4.594E-16	519	0.034	0.156	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
20	PDB:4c0tA	0.102	0.745	5.707E-16	291	0.029	0.234	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2F9	0.0	838	1634	0.185	0.269	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
2	E9PCD1	0.0	665	2217	0.139	0.150	E9PCD1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
3	F5GWT4	0.0	1462	2134	0.331	0.370	F5GWT4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=1
4	H0Y7T5	0.0	665	2220	0.139	0.150	H0Y7T5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
5	P83741	0.0	3739	2377	0.858	0.859	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
6	Q3UH66	0.0	671	2149	0.139	0.154	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
7	Q7TPK6	0.0	632	1222	0.118	0.230	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
8	Q80UE6	0.0	632	1222	0.118	0.230	WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus OX=10090 GN=Wnk4 PE=1 SV=1
9	Q80XP9	0.0	676	1757	0.150	0.203	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
10	Q96J92	0.0	633	1243	0.118	0.227	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
11	Q9BYP7	0.0	672	1800	0.142	0.188	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
12	Q9H4A3	0.0	4772	2382	1.000	1.000	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
13	Q9JIH7	0.0	1400	2126	0.308	0.345	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
14	Q9Y3S1	0.0	665	2297	0.139	0.145	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
15	X1WG08	0.0	838	1606	0.185	0.274	X1WG08_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=1
16	X5M5N0	7.11e-155	531	1850	0.102	0.131	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
17	M9PGC5	1.23e-143	503	2462	0.099	0.096	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
18	Q8S8Y9	3.47e-84	291	568	0.059	0.246	WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana OX=3702 GN=WNK2 PE=1 SV=1
19	Q9STK6	3.30e-83	286	516	0.071	0.328	WNK3_ARATH Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana OX=3702 GN=WNK3 PE=2 SV=1
20	Q944Q0	3.73e-81	281	563	0.055	0.231	WNK8_ARATH Serine/threonine-protein kinase WNK8 OS=Arabidopsis thaliana OX=3702 GN=WNK8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12202 OSR1_C	7.3e-28	107.8	Oxidative-stress-responsive kinase 1 C-terminal domain
2	PF00069 Pkinase	7.2e-51	184.7	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	4.8e-39	145.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000007718

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000029536	0.882	Uncharacterized protein
2	9598.ENSPTRP00000013456	0.825	Amiloride-sensitive sodium channel subunit gamma
3	9598.ENSPTRP00000007816	0.822	Amiloride-sensitive sodium channel subunit alpha
4	9598.ENSPTRP00000007639	0.804	Uncharacterized protein
5	9598.ENSPTRP00000029417	0.801	Uncharacterized protein
6	9598.ENSPTRP00000059043	0.773	Uncharacterized protein
7	9598.ENSPTRP00000013457	0.740	Amiloride-sensitive sodium channel subunit beta
8	9598.ENSPTRP00000021530	0.730	Serine threonine kinase 39
9	9598.ENSPTRP00000057037	0.722	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
10	9598.ENSPTRP00000025450	0.721	Oxidative-stress responsive 1
11	9598.ENSPTRP00000053274	0.711	Uncharacterized protein
12	9598.ENSPTRP00000016389	0.706	Uncharacterized protein
13	9598.ENSPTRP00000051339	0.703	Uncharacterized protein
14	9598.ENSPTRP00000056801	0.701	Uncharacterized protein
15	9598.ENSPTRP00000053973	0.675	Intersectin 1 (SH3 domain protein)
16	9598.ENSPTRP00000001788	0.671	Syntaxin binding protein 3
17	9598.ENSPTRP00000013899	0.670	Uncharacterized protein
18	9598.ENSPTRP00000028728	0.668	Family with sequence similarity 134, member B
19	9598.ENSPTRP00000060271	0.635	Ubiquitin A-52 residue ribosomal protein fusion product 1
20	9598.ENSPTRP00000054494	0.617	Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.935	enzyme binding
GO:0043167	0.912	ion binding
GO:0019901	0.903	protein kinase binding
GO:0032559	0.897	adenyl ribonucleotide binding
GO:0005524	0.894	ATP binding
GO:0098772	0.885	molecular function regulator activity
GO:0008200	0.879	ion channel inhibitor activity
GO:0019887	0.726	protein kinase regulator activity
GO:0019209	0.638	kinase activator activity
GO:0019902	0.626	phosphatase binding
GO:0030295	0.623	protein kinase activator activity
GO:0019869	0.549	chloride channel inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0006793	0.981	phosphorus metabolic process
GO:0071704	0.947	organic substance metabolic process
GO:0065007	0.937	biological regulation
GO:0044092	0.930	negative regulation of molecular function
GO:0050794	0.929	regulation of cellular process
GO:0044238	0.925	primary metabolic process
GO:0006796	0.923	phosphate-containing compound metabolic process
GO:0006807	0.910	nitrogen compound metabolic process
GO:0016310	0.908	phosphorylation
GO:1901564	0.901	organonitrogen compound metabolic process
GO:0006468	0.878	protein phosphorylation
GO:0048519	0.846	negative regulation of biological process
GO:0002682	0.840	regulation of immune system process
GO:0043086	0.818	negative regulation of catalytic activity
GO:0048583	0.796	regulation of response to stimulus
GO:0010033	0.758	response to organic substance
GO:0010959	0.710	regulation of metal ion transport
GO:0051716	0.703	cellular response to stimulus
GO:1990868	0.680	response to chemokine
GO:0051179	0.676	localization
GO:0070887	0.639	cellular response to chemical stimulus
GO:0002684	0.610	positive regulation of immune system process
GO:0006810	0.608	transport
GO:0034762	0.592	regulation of transmembrane transport
GO:0034260	0.587	negative regulation of GTPase activity
GO:0006811	0.581	monoatomic ion transport
GO:0018193	0.571	peptidyl-amino acid modification
GO:0006812	0.563	monoatomic cation transport
GO:0030001	0.544	metal ion transport
GO:1990869	0.542	cellular response to chemokine
GO:0098662	0.538	inorganic cation transmembrane transport
GO:0098655	0.538	monoatomic cation transmembrane transport
GO:0010646	0.523	regulation of cell communication
GO:0007154	0.502	cell communication
GO:0002685	0.497	regulation of leukocyte migration
GO:0048522	0.494	positive regulation of cellular process
GO:0071675	0.470	regulation of mononuclear cell migration
GO:0018210	0.468	peptidyl-threonine modification
GO:0030335	0.437	positive regulation of cell migration
GO:0023051	0.404	regulation of signaling
GO:0002687	0.380	positive regulation of leukocyte migration
GO:0071677	0.361	positive regulation of mononuclear cell migration
GO:0048878	0.354	chemical homeostasis
GO:0023052	0.352	signaling
GO:2000404	0.301	regulation of T cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.973	cytosol
GO:0032991	0.481	protein-containing complex
GO:0071944	0.410	cell periphery
GO:0005886	0.401	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]