StarFunc result for job id Q9H4B0

User Input

>input (414 residues)
MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNV
LGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGL
ALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALV
QGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIK
PPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKR
THRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNG
IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4B0	1.000	1.000	3.497E-83	414	1.000	1.000	Q9H4B0.pdb.gz	OSGL1_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=2
2	AFDB:Q6PEB4	0.917	0.917	1.107E-72	414	0.850	0.850	Q6PEB4.pdb.gz	OSGL1_MOUSE tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Osgepl1 PE=1 SV=2
3	AFDB:O22145	0.803	0.695	1.379E-38	480	0.372	0.321	O22145.pdb.gz	OSGP2_ARATH Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GCP1 PE=2 SV=2
4	AFDB:O05518	0.754	0.897	1.904E-33	346	0.287	0.344	O05518.pdb.gz	TSAD_BACSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tsaD PE=1 SV=1
5	AFDB:E2QE90	0.745	0.908	4.226E-32	337	0.295	0.362	E2QE90.pdb.gz	E2QE90_ECOLX tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli OX=562 GN=tsaD PE=3 SV=1
6	PDB:6z81A	0.750	0.902	6.384E-31	342	0.292	0.354	6z81A.pdb.gz	Structure of a reaction intermediate mimic in t6A biosynthesis bound in the active site of the TsaBD heterodimer from Escherichia coli.
7	AFDB:Q72B00	0.741	0.845	4.331E-29	361	0.271	0.310	Q72B00.pdb.gz	TSAD_DESVH tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=tsaD PE=1 SV=1
8	AFDB:P9WHT7	0.747	0.893	1.414E-28	344	0.261	0.314	P9WHT7.pdb.gz	TSAD_MYCTU tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsaD PE=1 SV=1
9	AFDB:O94710	0.734	0.738	2.098E-28	412	0.285	0.286	O94710.pdb.gz	QRI7_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp1 PE=3 SV=1
10	AFDB:P43122	0.766	0.779	2.804E-27	407	0.295	0.300	P43122.pdb.gz	QRI7_YEAST tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI7 PE=1 SV=1
11	AFDB:O49653	0.727	0.847	2.546E-25	353	0.229	0.269	O49653.pdb.gz	O49653_ARATH Glycoprotease 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
12	PDB:2ivnA	0.713	0.900	7.937E-25	325	0.244	0.311	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
13	PDB:6gwjK	0.720	0.885	1.197E-22	334	0.229	0.284	6gwjK.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
14	PDB:4k25A	0.647	0.746	1.207E-21	355	0.232	0.270	4k25A.pdb.gz	Reconstitution and characterization of eukaryotic N6-threonylcarbamoylation of tRNA using a minimal enzyme system.
15	PDB:4ehtA	0.431	0.617	8.545E-9	268	0.097	0.149	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
16	PDB:7t1hA	0.459	0.537	9.643E-8	342	0.114	0.137	7t1hA.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
17	PDB:4yduC	0.265	0.449	3.149E-7	230	0.075	0.135	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
18	PDB:7t1iB	0.434	0.542	4.174E-7	314	0.114	0.150	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
19	PDB:2ch5A	0.411	0.477	7.334E-7	344	0.097	0.116	2ch5A.pdb.gz
20	PDB:2aa4A	0.381	0.508	2.264E-6	289	0.138	0.197	2aa4A.pdb.gz	Crystal Structure of Escherichia Coli Putative N-Acetylmannosamine Kinase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PEB4	0.0	728	414	0.850	0.850	OSGL1_MOUSE tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Osgepl1 PE=1 SV=2
2	Q9H4B0	0.0	843	414	1.000	1.000	OSGL1_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=2
3	E7EVL7	1.23e-157	445	222	0.536	1.000	E7EVL7_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=1
4	E5RIL9	1.02e-142	406	203	0.490	1.000	E5RIL9_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEPL1 PE=1 SV=1
5	O22145	3.95e-81	259	480	0.372	0.321	OSGP2_ARATH Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GCP1 PE=2 SV=2
6	E2QE90	4.06e-56	190	337	0.302	0.371	E2QE90_ECOLX tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli OX=562 GN=tsaD PE=3 SV=1
7	P05852	4.06e-56	190	337	0.302	0.371	TSAD_ECOLI tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=tsaD PE=1 SV=2
8	O05518	5.22e-52	179	346	0.295	0.353	TSAD_BACSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tsaD PE=1 SV=1
9	O94710	4.37e-46	165	412	0.290	0.291	QRI7_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp1 PE=3 SV=1
10	Q72B00	1.18e-42	155	361	0.271	0.310	TSAD_DESVH tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=tsaD PE=1 SV=1
11	P9WHT7	3.76e-36	137	344	0.271	0.326	TSAD_MYCTU tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsaD PE=1 SV=1
12	P43122	1.52e-34	134	407	0.309	0.314	QRI7_YEAST tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI7 PE=1 SV=1
13	Q9UXT7	3.12e-32	126	324	0.249	0.318	KAE1_PYRAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=kae1 PE=1 SV=1
14	O49653	3.23e-30	121	353	0.234	0.275	O49653_ARATH Glycoprotease 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
15	Q9VV41	1.12e-29	119	347	0.256	0.305	OSGEP_DROME Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Drosophila melanogaster OX=7227 GN=Tcs3 PE=2 SV=1
16	Q9NPF4	1.01e-27	114	335	0.244	0.301	OSGEP_HUMAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1
17	O94637	2.00e-18	88.2	346	0.217	0.260	KAE1_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pgp2 PE=3 SV=1
18	P36132	6.71e-17	84.0	386	0.203	0.218	KAE1_YEAST tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAE1 PE=1 SV=2
19	Q8IJ99	3.96e-11	67.0	598	0.121	0.084	Q8IJ99_PLAF7 N(6)-L-threonylcarbamoyladenine synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1030600 PE=3 SV=1
20	G3V445	2.42e-07	52.0	149	0.111	0.309	G3V445_HUMAN N(6)-L-threonylcarbamoyladenine synthase (Fragment) OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01869 BcrAD_BadFG	24	15.9	BadF/BadG/BcrA/BcrD ATPase family
2	PF00814 TsaD	1.3e-73	259.6	tRNA N6-adenosine threonylcarbamoyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362135	0.981	YrdC domain-containing protein, mitochondrial
2	9606.ENSP00000361186	0.973	TP53-regulating kinase
3	9606.ENSP00000272424	0.964	EKC/KEOPS complex subunit TPRKB
4	9606.ENSP00000306320	0.924	EKC/KEOPS complex subunit GON7
5	9606.ENSP00000349923	0.922	EKC/KEOPS complex subunit LAGE3
6	9606.ENSP00000427882	0.910	Ankyrin and armadillo repeat containing
7	9606.ENSP00000261249	0.771	tRNA (guanine(37)-N1)-methyltransferase
8	9606.ENSP00000303427	0.768	Sister chromatid cohesion protein PDS5 homolog A
9	9606.ENSP00000313851	0.733	Sister chromatid cohesion protein PDS5 homolog B
10	9606.ENSP00000321810	0.723	tRNA dimethylallyltransferase
11	9606.ENSP00000381567	0.720	TATA element modulatory factor
12	9606.ENSP00000351686	0.717	PR domain zinc finger protein 10
13	9606.ENSP00000206542	0.714	Probable tRNA N6-adenosine threonylcarbamoyltransferase
14	9606.ENSP00000235521	0.698	Tryptophan--tRNA ligase, mitochondrial
15	9606.ENSP00000355890	0.674	Bifunctional glutamate/proline--tRNA ligase
16	9606.ENSP00000420682	0.667	Queuine tRNA-ribosyltransferase accessory subunit 2
17	9606.ENSP00000222511	0.656	GTP-binding protein 10
18	9606.ENSP00000402038	0.648	Protein MTO1 homolog, mitochondrial
19	9606.ENSP00000386292	0.634	Nuclear envelope integral membrane protein 2
20	9606.ENSP00000381949	0.629	Collagen alpha-1(XIII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016747	1.000	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0005488	0.992	binding
GO:0005515	0.974	protein binding
GO:0061711	0.670	N(6)-L-threonylcarbamoyladenine synthase activity
GO:1901363	0.462	heterocyclic compound binding
GO:0097159	0.450	organic cyclic compound binding
GO:0003676	0.329	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009451	0.997	RNA modification
GO:0006399	0.997	tRNA metabolic process
GO:0034470	0.996	ncRNA processing
GO:0006400	0.994	tRNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.504	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:37059	0.670	adenosine(37) in tRNA + L-threonylcarbamoyladenylate = AMP + H(+) + N(6)-L-threonylcarbamoyladenosine(37) in tRNA
EC:2.3.1.234	0.670	N(6)-L-threonylcarbamoyladenine synthase.

[back to server]