StarFunc result for job id Q9H4B4

User Input

>input (646 residues)
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R011	0.812	0.810	0.000	647	0.938	0.937	Q9R011.pdb.gz	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
2	AFDB:Q9NYY3	0.489	0.463	1.665E-72	685	0.500	0.472	Q9NYY3.pdb.gz	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
3	AFDB:A6H8T5	0.456	0.448	1.737E-71	657	0.494	0.486	A6H8T5.pdb.gz	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
4	AFDB:Q4FZD7	0.439	0.476	5.005E-62	595	0.382	0.415	Q4FZD7.pdb.gz	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
5	AFDB:F7HSC1	0.442	0.473	1.190E-59	603	0.385	0.413	F7HSC1.pdb.gz	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
6	AFDB:Q4KMI8	0.439	0.476	3.203E-59	595	0.375	0.407	Q4KMI8.pdb.gz	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
7	AFDB:P70032	0.433	0.467	2.181E-57	598	0.368	0.398	P70032.pdb.gz	PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1
8	AFDB:P52304	0.438	0.490	1.812E-54	576	0.347	0.389	P52304.pdb.gz	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
9	AFDB:Q9N2L7	0.437	0.447	1.908E-54	632	0.345	0.353	Q9N2L7.pdb.gz	PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans OX=6239 GN=plk-2 PE=1 SV=1
10	AFDB:P50528	0.443	0.419	2.011E-54	683	0.320	0.303	P50528.pdb.gz	PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plo1 PE=1 SV=1
11	PDB:5u6yA	0.382	0.530	8.875E-24	459	0.161	0.227	5u6yA.pdb.gz
12	PDB:7myjC	0.378	0.519	3.818E-23	465	0.163	0.226	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:4zhxA	0.379	0.590	9.259E-23	409	0.153	0.242	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:6b1uA	0.379	0.547	4.657E-22	442	0.163	0.238	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:5ufuA	0.379	0.652	8.703E-22	369	0.150	0.263	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:4rerA	0.380	0.531	2.223E-21	459	0.172	0.242	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:4c0tA	0.372	0.801	3.040E-21	291	0.135	0.299	4c0tA.pdb.gz
18	PDB:4rewA	0.379	0.587	9.080E-21	411	0.166	0.260	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6byrA	0.383	0.602	7.690E-20	405	0.128	0.205	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
20	PDB:5x3fB	0.373	0.671	2.180E-19	349	0.121	0.223	5x3fB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H8T5	0.0	640	657	0.495	0.487	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
2	P53351	0.0	644	682	0.500	0.474	PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus OX=10090 GN=Plk2 PE=1 SV=1
3	Q60806	0.0	1135	631	0.910	0.932	PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus OX=10090 GN=Plk3 PE=1 SV=2
4	Q9H4B4	0.0	1326	646	1.000	1.000	PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens OX=9606 GN=PLK3 PE=1 SV=2
5	Q9NYY3	0.0	644	685	0.492	0.464	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
6	Q9R011	0.0	1176	647	0.910	0.909	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
7	Q9R012	0.0	645	682	0.492	0.466	PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus OX=10116 GN=Plk2 PE=1 SV=1
8	Q4KMI8	8.04e-154	458	595	0.385	0.418	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
9	Q6DRK7	1.89e-153	457	595	0.387	0.420	Q6DRK7_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk1 PE=1 SV=1
10	Q07832	2.25e-152	455	603	0.402	0.431	PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus OX=10090 GN=Plk1 PE=1 SV=2
11	Q62673	6.84e-151	451	603	0.376	0.403	PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus OX=10116 GN=Plk1 PE=2 SV=2
12	P70032	1.17e-148	445	598	0.385	0.416	PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1
13	F7HSC1	1.50e-145	437	603	0.378	0.405	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
14	P53350	5.01e-145	436	603	0.384	0.411	PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1
15	Q4FZD7	1.21e-144	435	595	0.378	0.410	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
16	Q9N2L7	1.77e-138	420	632	0.361	0.369	PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans OX=6239 GN=plk-2 PE=1 SV=1
17	P52304	1.72e-137	416	576	0.356	0.399	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
18	P34331	2.38e-133	407	649	0.362	0.361	PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans OX=6239 GN=plk-1 PE=1 SV=3
19	P50528	5.27e-109	345	683	0.337	0.319	PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plo1 PE=1 SV=1
20	Q5ABG0	1.34e-96	312	653	0.299	0.296	Q5ABG0_CANAL Serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3.6	18.2	ABC1 atypical kinase-like domain
2	PF01636 APH	58	15.0	Phosphotransferase enzyme family
3	PF14531 Kinase-like	3.7e-05	34.8	Kinase-like
4	PF00069 Pkinase	5.4e-68	240.8	Protein kinase domain
5	PF17667 Pkinase_fungal	0.01	26.3	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	2.6e-33	127.0	Protein tyrosine and serine/threonine kinase
7	PF00659 POLO_box	2.3e-26	103.0	POLO box duplicated region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361275

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321656	0.990	M-phase inducer phosphatase 3
2	9606.ENSP00000269305	0.989	Cellular tumor antigen p53
3	9606.ENSP00000372023	0.986	Serine/threonine-protein kinase Chk2
4	9606.ENSP00000278616	0.960	Serine-protein kinase ATM
5	9606.ENSP00000343741	0.930	Serine/threonine-protein kinase ATR
6	9606.ENSP00000405963	0.909	Ras-specific guanine nucleotide-releasing factor 1
7	9606.ENSP00000248975	0.904	14-3-3 protein eta
8	9606.ENSP00000367545	0.904	Tumor protein p73
9	9606.ENSP00000381958	0.860	Kinase suppressor of Ras 1
10	9606.ENSP00000371194	0.857	Lymphocyte-specific protein 1
11	9606.ENSP00000296509	0.842	Mitotic spindle assembly checkpoint protein MAD2A
12	9606.ENSP00000360532	0.825	Cell division cycle 5-like protein
13	9606.ENSP00000479860	0.814	Calcium and integrin binding 1
14	9606.ENSP00000260731	0.812	Kinesin-like protein KIF11
15	9606.ENSP00000251849	0.809	RAF proto-oncogene serine/threonine-protein kinase
16	9606.ENSP00000315477	0.803	CD209 antigen
17	9606.ENSP00000316228	0.803	C-type lectin domain family 4 member M
18	9606.ENSP00000287598	0.790	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
19	9606.ENSP00000256442	0.782	G2/mitotic-specific cyclin-B1
20	9606.ENSP00000354916	0.762	Dual specificity protein phosphatase CDC14A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.481	enzyme binding
GO:0019900	0.451	kinase binding
GO:0042802	0.351	identical protein binding
GO:0019901	0.322	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0044237	0.986	cellular metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0043170	0.984	macromolecule metabolic process
GO:0044238	0.981	primary metabolic process
GO:0006793	0.977	phosphorus metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:0006468	0.970	protein phosphorylation
GO:0050896	0.952	response to stimulus
GO:0007093	0.940	mitotic cell cycle checkpoint signaling
GO:2000045	0.939	regulation of G1/S transition of mitotic cell cycle
GO:1901991	0.937	negative regulation of mitotic cell cycle phase transition
GO:2000134	0.907	negative regulation of G1/S transition of mitotic cell cycle
GO:0006974	0.905	cellular response to DNA damage stimulus
GO:0044819	0.897	mitotic G1/S transition checkpoint signaling
GO:0071840	0.613	cellular component organization or biogenesis
GO:0048518	0.609	positive regulation of biological process
GO:0016043	0.569	cellular component organization
GO:0019222	0.556	regulation of metabolic process
GO:0060255	0.522	regulation of macromolecule metabolic process
GO:0006996	0.506	organelle organization
GO:0080090	0.504	regulation of primary metabolic process
GO:0051171	0.504	regulation of nitrogen compound metabolic process
GO:0048522	0.459	positive regulation of cellular process
GO:0031323	0.449	regulation of cellular metabolic process
GO:0042770	0.311	signal transduction in response to DNA damage
GO:0031570	0.311	DNA integrity checkpoint signaling
GO:0048583	0.305	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.996	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0012505	0.960	endomembrane system
GO:0005829	0.931	cytosol
GO:0015630	0.902	microtubule cytoskeleton
GO:0005694	0.876	chromosome
GO:0005815	0.672	microtubule organizing center
GO:0005813	0.502	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]