StarFunc result for job id Q9H4B6

User Input

>input (383 residues)
MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAF
STSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEV
SFAVENGDSGSRYYYSDNFFDGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGI
GRVAATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGW
ERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPYH
TAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQA
LLTELENRKQRQQWYAQQHGKNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VEB2	0.602	0.597	1.642E-56	386	0.943	0.935	Q8VEB2.pdb.gz	SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus OX=10090 GN=Sav1 PE=1 SV=2
2	AFDB:Q66HX5	0.305	0.297	1.277E-40	397	0.676	0.652	Q66HX5.pdb.gz	Q66HX5_DANRE Protein salvador homolog 1 OS=Danio rerio OX=7955 GN=zgc:92250 PE=2 SV=1
3	AFDB:F6P346	0.140	0.069	8.107E-8	867	0.144	0.063	F6P346.pdb.gz	F6P346_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
4	AFDB:Q76N89	0.094	0.024	6.293E-4	1606	0.154	0.037	Q76N89.pdb.gz	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
5	PDB:1nmvA	0.081	0.181	2.446E-2	163	0.037	0.086	1nmvA.pdb.gz
6	PDB:1yw5A	0.077	0.165	2.777E-2	177	0.034	0.073	1yw5A.pdb.gz
7	PDB:7kkfA	0.077	0.178	4.920E-2	162	0.023	0.056	7kkfA.pdb.gz
8	AFDB:Q9BYW2	0.088	0.016	1.080E-1	2564	0.104	0.016	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
9	AFDB:A0A1Y7VMP7	0.087	0.032	1.151E-1	1443	0.154	0.041	A0A1Y7VMP7.pdb.gz	A0A1Y7VMP7_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
10	AFDB:Q61084	0.065	0.044	3.848E-1	626	0.112	0.069	Q61084.pdb.gz	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
11	AFDB:O01737	0.061	0.022	4.101E-1	1866	0.110	0.023	O01737.pdb.gz	SBNO_CAEEL Protein strawberry notch homolog OS=Caenorhabditis elegans OX=6239 GN=let-765 PE=1 SV=3
12	AFDB:Q5RFW2	0.115	0.069	4.370E-1	711	0.198	0.107	Q5RFW2.pdb.gz	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
13	PDB:6rtdB	0.072	0.064	4.545E-1	466	0.029	0.024	6rtdB.pdb.gz	Crystal Structure of Dihydro-Heme d1Dehydrogenase NirN from Pseudomonas aeruginosa Reveals Amino Acid Residues Essential for Catalysis.
14	PDB:5yzgY	0.093	0.144	5.161E-1	204	0.055	0.103	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:6y0fC	0.064	0.042	5.161E-1	722	0.023	0.012	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
16	PDB:4wjlB	0.074	0.046	5.499E-1	719	0.026	0.014	4wjlB.pdb.gz
17	AFDB:E7EXX1	0.078	0.052	5.634E-1	626	0.107	0.065	E7EXX1.pdb.gz
18	PDB:6drtA	0.106	0.159	8.579E-1	230	0.023	0.039	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
19	PDB:7cztH	0.042	0.060	9.741E-1	221	0.016	0.027	7cztH.pdb.gz
20	PDB:7mq8LS	0.061	0.053	9.741E-1	453	0.018	0.015	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YJH0	0.0	639	312	0.796	0.978	H0YJH0_HUMAN Salvador family WW domain containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAV1 PE=1 SV=1
2	Q8VEB2	0.0	761	386	0.943	0.935	SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus OX=10090 GN=Sav1 PE=1 SV=2
3	Q9H4B6	0.0	801	383	1.000	1.000	SAV1_HUMAN Protein salvador homolog 1 OS=Homo sapiens OX=9606 GN=SAV1 PE=1 SV=2
4	Q66HX5	1.29e-165	471	397	0.681	0.657	Q66HX5_DANRE Protein salvador homolog 1 OS=Danio rerio OX=7955 GN=zgc:92250 PE=2 SV=1
5	Q9VCR6	2.45e-48	174	608	0.243	0.153	SAV_DROME Scaffold protein salvador OS=Drosophila melanogaster OX=7227 GN=sav PE=1 SV=2
6	C1P633	1.52e-18	90.1	1054	0.123	0.045	C1P633_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
7	C1P635	1.67e-18	89.7	1004	0.123	0.047	C1P635_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=2
8	C1P634	1.72e-18	89.7	855	0.123	0.055	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
9	C6KRJ8	1.86e-18	89.7	802	0.123	0.059	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
10	Q9W2L2	1.33e-14	77.8	1202	0.091	0.029	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
11	Q5F488	4.10e-13	73.2	1128	0.089	0.030	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
12	Q9JK71	5.07e-13	73.2	1470	0.089	0.023	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
13	Q5TCQ9	5.36e-13	73.2	1481	0.089	0.023	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
14	Q9EQJ9	5.81e-13	72.8	1476	0.089	0.023	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
15	F1Q897	1.28e-12	72.0	1503	0.084	0.021	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
16	Q9WVQ1	1.37e-12	71.6	1275	0.084	0.025	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
17	Q86UL8	1.49e-12	71.6	1455	0.084	0.022	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
18	O88382	2.99e-12	70.9	1277	0.081	0.024	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
19	H7C5T8	5.20e-12	69.7	1014	0.097	0.036	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
20	H7C4U7	6.02e-12	69.7	1131	0.097	0.033	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06047 Nkap_C	4.7e+02	12.3	NF-kappa-B-activating protein C-terminal domain
2	PF00397 WW	1e-09	49.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361892	0.999	Serine/threonine-protein kinase 4
2	9606.ENSP00000437550	0.999	Serine/threonine-protein kinase LATS1
3	9606.ENSP00000429744	0.998	Serine/threonine-protein kinase 3
4	9606.ENSP00000372035	0.997	Serine/threonine-protein kinase LATS2
5	9606.ENSP00000379364	0.990	MOB kinase activator 1A
6	9606.ENSP00000379366	0.984	MOB kinase activator 1B
7	9606.ENSP00000349547	0.972	Ras association domain-containing protein 1
8	9606.ENSP00000478927	0.950	Transcriptional coactivator YAP1
9	9606.ENSP00000419465	0.944	WW domain-containing transcription regulator protein 1
10	9606.ENSP00000466953	0.944	Wilms tumor protein 1-interacting protein
11	9606.ENSP00000361027	0.936	Angiomotin
12	9606.ENSP00000262713	0.932	LIM domain-containing protein ajuba
13	9606.ENSP00000311032	0.922	Caspase-3
14	9606.ENSP00000273317	0.898	LIM domain-containing protein 1
15	9606.ENSP00000355966	0.875	Serine/threonine-protein kinase Nek2
16	9606.ENSP00000344666	0.841	Merlin
17	9606.ENSP00000387739	0.840	Angiomotin-like protein 1
18	9606.ENSP00000365730	0.838	Serine/threonine-protein kinase 24
19	9606.ENSP00000424765	0.826	Angiomotin-like protein 2
20	9606.ENSP00000435233	0.789	Transcriptional enhancer factor TEF-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.707	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0051716	0.973	cellular response to stimulus
GO:0048519	0.973	negative regulation of biological process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0007154	0.955	cell communication
GO:0023052	0.953	signaling
GO:0031323	0.948	regulation of cellular metabolic process
GO:0048522	0.943	positive regulation of cellular process
GO:0007165	0.930	signal transduction
GO:0048856	0.928	anatomical structure development
GO:0048523	0.919	negative regulation of cellular process
GO:0007275	0.913	multicellular organism development
GO:0065009	0.861	regulation of molecular function
GO:0019219	0.849	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.847	regulation of cellular biosynthetic process
GO:0010468	0.842	regulation of gene expression
GO:0010556	0.842	regulation of macromolecule biosynthetic process
GO:0035556	0.839	intracellular signal transduction
GO:0030154	0.822	cell differentiation
GO:0009888	0.766	tissue development
GO:0050793	0.722	regulation of developmental process
GO:0006355	0.695	regulation of DNA-templated transcription
GO:0044093	0.672	positive regulation of molecular function
GO:0071840	0.584	cellular component organization or biogenesis
GO:0065008	0.575	regulation of biological quality
GO:0048513	0.509	animal organ development
GO:0048731	0.495	system development
GO:0016043	0.487	cellular component organization
GO:0009653	0.407	anatomical structure morphogenesis
GO:0010646	0.386	regulation of cell communication
GO:0023051	0.380	regulation of signaling
GO:0009893	0.379	positive regulation of metabolic process
GO:0042981	0.364	regulation of apoptotic process
GO:0048583	0.362	regulation of response to stimulus
GO:0010604	0.348	positive regulation of macromolecule metabolic process
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0009966	0.323	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0031974	0.896	membrane-enclosed lumen
GO:0070013	0.875	intracellular organelle lumen
GO:0031981	0.862	nuclear lumen
GO:0043228	0.550	non-membrane-bounded organelle
GO:0043232	0.448	intracellular non-membrane-bounded organelle
GO:0005654	0.368	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]