StarFunc result for job id Q9H4D0

User Input

>input (955 residues)
MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHGVITENNDTVI
LDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEY
TFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQ
VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQ
KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSLQIVTE
LQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDG
RQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHN
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLV
TNDWPIHPSHIAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQA
CKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRR
LKVSSKVQCFGEDVCISIPEVDAYVMVLQAIEPRITLRGTDHFWRPAAQFESARGVTLFP
DIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDILVIGGDLDPRQECLELNHSEL
HQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIKCSELNGRYTS
NEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIIS
VCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDE
TEGEEEEEAEEEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDDSTLPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0S5G3	0.784	0.798	0.000	937	0.641	0.653	B0S5G3.pdb.gz	CSTN2_DANRE calsyntenin-2 OS=Danio rerio OX=7955 GN=clstn2a PE=1 SV=1
2	AFDB:E7EYL3	0.606	0.597	0.000	971	0.559	0.550	E7EYL3.pdb.gz
3	AFDB:O94985	0.610	0.597	0.000	981	0.556	0.541	O94985.pdb.gz	CSTN1_HUMAN Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE=1 SV=1
4	AFDB:Q6Q0N0	0.591	0.593	0.000	952	0.547	0.548	Q6Q0N0.pdb.gz	CSTN1_RAT Calsyntenin-1 OS=Rattus norvegicus OX=10116 GN=Clstn1 PE=1 SV=1
5	AFDB:Q8R553	0.565	0.564	0.000	957	0.474	0.473	Q8R553.pdb.gz	CSTN3_RAT Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Clstn3 PE=2 SV=1
6	AFDB:Q9ER65	0.819	0.810	0.000	966	0.931	0.920	Q9ER65.pdb.gz	CSTN2_MOUSE Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2
7	AFDB:Q7ZTX9	0.239	0.689	1.423E-38	317	0.186	0.562	Q7ZTX9.pdb.gz
8	AFDB:Q8C8Z3	0.211	0.252	3.972E-24	794	0.124	0.149	Q8C8Z3.pdb.gz	Q8C8Z3_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdhb22 PE=2 SV=1
9	AFDB:A0PJT6	0.216	0.259	8.365E-24	789	0.129	0.156	A0PJT6.pdb.gz	A0PJT6_MOUSE Protocadherin beta 12 OS=Mus musculus OX=10090 GN=Pcdhb12 PE=2 SV=1
10	AFDB:Q9Y5F1	0.208	0.248	1.127E-23	795	0.114	0.137	Q9Y5F1.pdb.gz	PCDBC_HUMAN Protocadherin beta-12 OS=Homo sapiens OX=9606 GN=PCDHB12 PE=1 SV=1
11	PDB:6velC	0.162	0.619	8.158E-11	209	0.048	0.220	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:4aq1A	0.089	0.106	1.147E-7	721	0.061	0.080	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:5n0cA	0.139	0.107	4.839E-7	1293	0.041	0.030	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
14	PDB:3v0aB	0.150	0.126	3.893E-6	1150	0.057	0.047	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
15	PDB:1e07A	0.106	0.137	6.722E-6	642	0.057	0.084	1e07A.pdb.gz
16	PDB:7zl1A	0.145	0.557	7.801E-6	215	0.038	0.167	7zl1A.pdb.gz
17	PDB:7eebE	0.094	0.088	9.054E-6	1053	0.117	0.106	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	PDB:3ffzA	0.150	0.118	9.999E-6	1246	0.038	0.029	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
19	PDB:5oj2B	0.091	0.119	1.415E-5	692	0.082	0.113	5oj2B.pdb.gz
20	PDB:7vonA	0.084	0.063	1.643E-5	1399	0.084	0.057	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S5G3	0.0	1277	937	0.648	0.661	CSTN2_DANRE calsyntenin-2 OS=Danio rerio OX=7955 GN=clstn2a PE=1 SV=1
2	F1R520	0.0	1120	954	0.560	0.561	CSTN1_DANRE calsyntenin-1 OS=Danio rerio OX=7955 GN=clstn1 PE=1 SV=1
3	O94985	0.0	1076	981	0.547	0.532	CSTN1_HUMAN Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE=1 SV=1
4	Q6Q0N0	0.0	1057	952	0.541	0.543	CSTN1_RAT Calsyntenin-1 OS=Rattus norvegicus OX=10116 GN=Clstn1 PE=1 SV=1
5	Q8R553	0.0	896	957	0.466	0.465	CSTN3_RAT Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Clstn3 PE=2 SV=1
6	Q8VDA1	0.0	1736	965	0.898	0.889	CSTN2_RAT Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Clstn2 PE=2 SV=1
7	Q99JH7	0.0	906	956	0.473	0.473	CSTN3_MOUSE Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 PE=1 SV=1
8	Q9BQT9	0.0	886	956	0.470	0.470	CSTN3_HUMAN Calsyntenin-3 OS=Homo sapiens OX=9606 GN=CLSTN3 PE=1 SV=1
9	Q9EPL2	0.0	1045	979	0.545	0.531	CSTN1_MOUSE Calsyntenin-1 OS=Mus musculus OX=10090 GN=Clstn1 PE=1 SV=1
10	Q9ER65	0.0	1747	966	0.897	0.887	CSTN2_MOUSE Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2
11	G5ED46	5.48e-102	343	984	0.236	0.229	CASY1_CAEEL Calsyntenin-1 OS=Caenorhabditis elegans OX=6239 GN=casy-1 PE=1 SV=1
12	Q14517	1.36e-10	68.2	4588	0.048	0.010	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
13	Q19319	1.41e-10	68.2	4328	0.053	0.012	CADH4_CAEEL Cadherin-4 OS=Caenorhabditis elegans OX=6239 GN=cdh-4 PE=1 SV=4
14	Q9WU10	3.06e-10	67.0	4589	0.050	0.010	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
15	Q9NYQ8	1.23e-09	65.1	4349	0.067	0.015	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
16	O88277	1.71e-09	64.7	4351	0.063	0.014	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
17	A0PJT6	4.80e-09	62.8	789	0.067	0.081	A0PJT6_MOUSE Protocadherin beta 12 OS=Mus musculus OX=10090 GN=Pcdhb12 PE=2 SV=1
18	Q91Y07	5.19e-09	62.8	789	0.067	0.081	Q91Y07_MOUSE Protocadherin beta 12 OS=Mus musculus OX=10090 GN=Pcdhb12 PE=2 SV=1
19	Q9QXA3	5.78e-09	62.8	4587	0.061	0.013	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
20	A0A1L1SQU7	5.98e-09	62.8	4645	0.061	0.012	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	3.9e-11	54.6	Cadherin domain
2	PF19699 CLSTN_C	3e-129	442.5	Calsyntenin C-terminal
3	PF00722 Glyco_hydro_16	3.3e+02	12.2	Glycosyl hydrolases family 16
4	PF13385 Laminin_G_3	3.1	19.4	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340523	0.910	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
2	9606.ENSP00000027335	0.794	Cadherin-17
3	9606.ENSP00000399403	0.757	Kinesin light chain 2
4	9606.ENSP00000275730	0.694	Solute carrier family 12 member 9
5	9606.ENSP00000387549	0.649	Chromaffin granule amine transporter
6	9606.ENSP00000381098	0.643	Glutamate receptor-interacting protein 1
7	9606.ENSP00000478645	0.620	Islet cell autoantigen 1-like protein
8	9606.ENSP00000309432	0.604	Reticulophagy regulator 3
9	9606.ENSP00000345752	0.580	Myotubularin-related protein 2
10	9606.ENSP00000258484	0.572	Enhancer of polycomb homolog 2
11	9606.ENSP00000453293	0.562	Amyloid-beta A4 precursor protein-binding family A member 2
12	9606.ENSP00000288710	0.561	Dynein regulatory complex protein 1
13	9606.ENSP00000384638	0.561	Catenin alpha-2
14	9606.ENSP00000362841	0.553	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1
15	9606.ENSP00000362824	0.548	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
16	9606.ENSP00000435466	0.543	Kin of IRRE-like protein 3
17	9606.ENSP00000298472	0.542	Synaptic vesicular amine transporter
18	9606.ENSP00000345985	0.538	Leucine-rich repeat and fibronectin type-III domain-containing protein 2
19	9606.ENSP00000412524	0.530	Transmembrane protein 169
20	9606.ENSP00000427772	0.528	Protein KIBRA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042988	0.533	X11-like protein binding
GO:0019894	0.492	kinesin binding
GO:0001540	0.490	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0050793	0.894	regulation of developmental process
GO:0065008	0.892	regulation of biological quality
GO:0048518	0.835	positive regulation of biological process
GO:0048522	0.808	positive regulation of cellular process
GO:0010646	0.771	regulation of cell communication
GO:0051128	0.755	regulation of cellular component organization
GO:0051963	0.741	regulation of synapse assembly
GO:0023051	0.716	regulation of signaling
GO:0051239	0.696	regulation of multicellular organismal process
GO:1901890	0.694	positive regulation of cell junction assembly
GO:0050806	0.557	positive regulation of synaptic transmission
GO:0051965	0.557	positive regulation of synapse assembly
GO:0007155	0.468	cell adhesion
GO:0098609	0.355	cell-cell adhesion
GO:0098742	0.339	cell-cell adhesion via plasma-membrane adhesion molecules

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005886	0.999	plasma membrane
GO:0098590	0.993	plasma membrane region
GO:0045202	0.992	synapse
GO:0045211	0.983	postsynaptic membrane
GO:0043226	0.972	organelle
GO:0005622	0.782	intracellular anatomical structure
GO:0043231	0.750	intracellular membrane-bounded organelle
GO:0009986	0.657	cell surface
GO:0005737	0.552	cytoplasm
GO:0014069	0.444	postsynaptic density
GO:0098978	0.397	glutamatergic synapse
GO:0098839	0.355	postsynaptic density membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]