StarFunc result for job id Q9H4E5

User Input

>input (214 residues)
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAV
TVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
DCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQ
KGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ER71	0.895	0.895	1.127E-41	214	0.930	0.930	Q9ER71.pdb.gz	RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus OX=10090 GN=Rhoj PE=1 SV=2
2	AFDB:P17081	0.847	0.884	3.542E-34	205	0.720	0.751	P17081.pdb.gz	RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens OX=9606 GN=RHOQ PE=1 SV=2
3	AFDB:P0CY33	0.840	0.939	1.094E-30	191	0.533	0.597	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
4	AFDB:P40793	0.851	0.952	1.594E-30	191	0.556	0.623	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
5	AFDB:Q01112	0.861	0.958	1.808E-30	192	0.533	0.594	Q01112.pdb.gz	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
6	AFDB:G5EBV3	0.858	0.939	2.634E-30	195	0.463	0.508	G5EBV3.pdb.gz	G5EBV3_CAEEL Rac-like GTPase OS=Caenorhabditis elegans OX=6239 GN=mig-2 PE=1 SV=1
7	AFDB:Q05062	0.849	0.950	3.180E-30	191	0.551	0.618	Q05062.pdb.gz	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
8	AFDB:Q7JWS8	0.856	0.937	1.048E-29	195	0.495	0.544	Q7JWS8.pdb.gz	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
9	AFDB:P19073	0.831	0.930	1.116E-29	191	0.519	0.581	P19073.pdb.gz	CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC42 PE=1 SV=2
10	AFDB:A2BHI1	0.871	0.852	1.435E-29	219	0.519	0.507	A2BHI1.pdb.gz
11	PDB:2atxA	0.813	0.932	1.036E-28	186	0.692	0.796	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
12	PDB:1nf3A	0.821	0.904	1.640E-27	194	0.551	0.608	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
13	PDB:2wkpA	0.820	0.551	5.405E-27	320	0.509	0.341	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
14	PDB:6hxuA	0.821	0.961	8.558E-26	182	0.416	0.489	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
15	PDB:5c2kA	0.814	0.460	4.661E-25	382	0.421	0.236	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:6jikA	0.809	0.949	9.298E-25	182	0.411	0.484	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
17	PDB:4mitC	0.820	0.967	9.901E-25	181	0.421	0.497	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
18	PDB:6ukaA	0.798	0.961	5.392E-24	177	0.449	0.542	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
19	PDB:3a58F	0.817	0.962	9.681E-23	181	0.402	0.475	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.752	0.867	6.100E-21	184	0.425	0.495	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4E5	2.89e-161	445	214	1.000	1.000	RHOJ_HUMAN Rho-related GTP-binding protein RhoJ OS=Homo sapiens OX=9606 GN=RHOJ PE=1 SV=1
2	Q9ER71	4.64e-145	404	214	0.930	0.930	RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus OX=10090 GN=Rhoj PE=1 SV=2
3	P17081	3.96e-109	313	205	0.729	0.761	RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens OX=9606 GN=RHOQ PE=1 SV=2
4	V9HWD0	3.96e-109	313	205	0.729	0.761	V9HWD0_HUMAN Epididymis secretory protein Li 42 OS=Homo sapiens OX=9606 GN=HEL-S-42 PE=1 SV=1
5	Q8R527	6.77e-109	312	205	0.729	0.761	RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus OX=10090 GN=Rhoq PE=1 SV=2
6	Q9JJL4	6.77e-109	312	205	0.729	0.761	RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus OX=10116 GN=Rhoq PE=2 SV=1
7	Q6PFU4	2.72e-86	254	191	0.561	0.628	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
8	P60766	2.82e-86	254	191	0.561	0.628	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
9	P60953	2.82e-86	254	191	0.561	0.628	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
10	Q8CFN2	2.82e-86	254	191	0.561	0.628	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
11	Q52WY2	4.20e-85	252	191	0.547	0.613	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
12	P40793	1.01e-84	251	191	0.556	0.623	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
13	Q05062	2.05e-84	250	191	0.556	0.623	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
14	A9JRY8	5.90e-81	241	192	0.537	0.599	A9JRY8_DANRE Rac family small GTPase 3b OS=Danio rerio OX=7955 GN=rac3b PE=1 SV=1
15	Q01112	8.94e-81	241	192	0.537	0.599	CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc42 PE=1 SV=1
16	P62998	2.82e-80	239	192	0.533	0.594	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
17	P63000	2.82e-80	239	192	0.533	0.594	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
18	P63001	2.82e-80	239	192	0.533	0.594	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
19	Q6LC82	2.82e-80	239	192	0.533	0.594	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
20	Q6RUV5	2.82e-80	239	192	0.533	0.594	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.033	25.1	ADP-ribosylation factor family
2	PF00071 Ras	6.4e-45	164.2	Ras family
3	PF08477 Roc	4.4e-15	67.4	Ras of Complex, Roc, domain of DAPkinase
4	PF05621 TniB	3.9e+02	11.8	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003924467.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010334823.1	0.876	Rho guanine nucleotide exchange factor 28 isoform X1
2	27679.XP_010336602.1	0.861	Intersectin-1 isoform X1
3	27679.XP_010344076.1	0.861	Intersectin-2 isoform X1
4	27679.XP_010334148.1	0.854	Protein kinase C iota type
5	27679.XP_010337147.1	0.850	Rho guanine nucleotide exchange factor 7 isoform X1
6	27679.XP_010341384.1	0.849	LOW QUALITY PROTEIN: pleckstrin homology domain-containing family G member 4B
7	27679.XP_003932242.1	0.833	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
8	27679.XP_010341422.1	0.831	Partitioning defective 6 homolog beta
9	27679.XP_010329746.1	0.827	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 112 ESTs, 2 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
10	27679.XP_010342587.1	0.824	T-lymphoma invasion and metastasis-inducing protein 2 isoform X1
11	27679.XP_003940775.1	0.823	Proto-oncogene DBL
12	27679.XP_010341386.1	0.816	Triple functional domain protein
13	27679.XP_003929722.1	0.800	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
14	27679.XP_003931694.2	0.798	Rho GDP-dissociation inhibitor 1 isoform X1
15	27679.XP_003940783.1	0.790	Rho guanine nucleotide exchange factor 6 isoform X1
16	27679.XP_010343169.1	0.781	Delphilin
17	27679.XP_003929271.1	0.777	Rho guanine nucleotide exchange factor 15
18	27679.XP_010328497.1	0.774	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
19	27679.XP_003927721.1	0.768	T-lymphoma invasion and metastasis-inducing protein 1
20	27679.XP_010331125.1	0.768	Rho GTPase-activating protein SYDE1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003924	0.938	GTPase activity
GO:1901363	0.871	heterocyclic compound binding
GO:0097159	0.869	organic cyclic compound binding
GO:0043167	0.851	ion binding
GO:0097367	0.818	carbohydrate derivative binding
GO:0043168	0.817	anion binding
GO:0036094	0.809	small molecule binding
GO:0032553	0.651	ribonucleotide binding
GO:0032555	0.567	purine ribonucleotide binding
GO:0035639	0.539	purine ribonucleoside triphosphate binding
GO:0032561	0.536	guanyl ribonucleotide binding
GO:0005525	0.533	GTP binding
GO:0019899	0.444	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0030029	0.977	actin filament-based process
GO:0050896	0.963	response to stimulus
GO:0071840	0.950	cellular component organization or biogenesis
GO:0016043	0.941	cellular component organization
GO:0030036	0.928	actin cytoskeleton organization
GO:0050793	0.892	regulation of developmental process
GO:0040012	0.865	regulation of locomotion
GO:0048518	0.847	positive regulation of biological process
GO:0048522	0.835	positive regulation of cellular process
GO:0051239	0.792	regulation of multicellular organismal process
GO:0051716	0.779	cellular response to stimulus
GO:0022603	0.764	regulation of anatomical structure morphogenesis
GO:0007165	0.729	signal transduction
GO:2000145	0.676	regulation of cell motility
GO:0030334	0.642	regulation of cell migration
GO:0032501	0.588	multicellular organismal process
GO:0010632	0.587	regulation of epithelial cell migration
GO:0010594	0.543	regulation of endothelial cell migration
GO:0043535	0.516	regulation of blood vessel endothelial cell migration
GO:0048583	0.434	regulation of response to stimulus
GO:0048856	0.398	anatomical structure development
GO:0045765	0.383	regulation of angiogenesis
GO:0030335	0.362	positive regulation of cell migration
GO:0048519	0.337	negative regulation of biological process
GO:1903670	0.336	regulation of sprouting angiogenesis
GO:0009966	0.327	regulation of signal transduction
GO:0010595	0.305	positive regulation of endothelial cell migration
GO:0048523	0.301	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043226	0.997	organelle
GO:0043227	0.981	membrane-bounded organelle
GO:0005576	0.948	extracellular region
GO:0005622	0.921	intracellular anatomical structure
GO:0070062	0.920	extracellular exosome
GO:0005737	0.908	cytoplasm
GO:0043229	0.823	intracellular organelle
GO:0043231	0.715	intracellular membrane-bounded organelle
GO:0012505	0.561	endomembrane system
GO:0005829	0.329	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.938	GTP + H2O = GDP + H(+) + phosphate

[back to server]