StarFunc result for job id Q9H4F1

User Input

>input (302 residues)
MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYS
SVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRST
LRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQ
VYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCR
EKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWR
TE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H4F1	1.000	1.000	1.915E-68	302	1.000	1.000	Q9H4F1.pdb.gz	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
2	AFDB:Q64686	0.808	0.800	7.076E-42	305	0.464	0.459	Q64686.pdb.gz	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
3	AFDB:Q8NDV1	0.811	0.803	1.391E-39	305	0.447	0.443	Q8NDV1.pdb.gz	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
4	AFDB:Q9BVH7	0.819	0.738	4.349E-36	336	0.430	0.387	Q9BVH7.pdb.gz	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
5	AFDB:Q969X2	0.781	0.710	7.310E-30	333	0.374	0.339	Q969X2.pdb.gz	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
6	AFDB:Q76K27	0.510	0.307	7.795E-14	524	0.195	0.113	Q76K27.pdb.gz	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
7	AFDB:P13721	0.548	0.419	8.839E-14	403	0.175	0.132	P13721.pdb.gz	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
8	AFDB:Q96JF0	0.525	0.313	1.557E-13	529	0.189	0.108	Q96JF0.pdb.gz	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
9	AFDB:O43173	0.551	0.449	1.880E-13	380	0.232	0.184	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
10	AFDB:B0CN48	0.556	0.460	2.574E-13	374	0.215	0.174	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
11	PDB:6aplC	0.536	0.529	4.159E-10	306	0.166	0.163	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:7uq0B	0.172	0.171	1.726E-2	307	0.079	0.078	7uq0B.pdb.gz
13	PDB:2plaA	0.173	0.159	3.039E-2	343	0.063	0.055	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
14	PDB:1oc4A	0.205	0.199	3.236E-2	315	0.066	0.063	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
15	PDB:6f2cA	0.169	0.311	5.025E-2	124	0.046	0.113	6f2cA.pdb.gz
16	PDB:1fdtA	0.147	0.152	6.462E-2	285	0.106	0.112	1fdtA.pdb.gz	The structure of a complex of human 17beta-hydroxysteroid dehydrogenase with estradiol and NADP+ identifies two principal targets for the design of inhibitors.
17	PDB:4fgwA	0.141	0.126	8.849E-2	353	0.030	0.025	4fgwA.pdb.gz
18	PDB:1qfjA	0.137	0.169	9.423E-2	226	0.079	0.106	1qfjA.pdb.gz
19	PDB:7ln6F	0.138	0.076	9.423E-2	714	0.060	0.025	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
20	PDB:2zpaB	0.137	0.078	1.003E-1	662	0.060	0.027	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4F1	0.0	630	302	1.000	1.000	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
2	Q64686	1.23e-94	284	305	0.437	0.433	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
3	Q8NDV1	8.19e-94	281	305	0.421	0.416	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
4	Q9BVH7	2.12e-81	251	336	0.414	0.372	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
5	Q9QYJ1	1.02e-79	247	336	0.407	0.366	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
6	Q9JM95	5.14e-65	209	333	0.328	0.297	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
7	Q969X2	2.79e-64	207	333	0.331	0.300	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
8	A0A087WWK2	2.83e-45	152	139	0.219	0.475	A0A087WWK2_HUMAN ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
9	Q11204	5.27e-20	90.9	350	0.228	0.197	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
10	Q11205	6.88e-20	90.5	350	0.228	0.197	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
11	Q16842	1.03e-18	87.0	350	0.222	0.191	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
12	Q08BF4	2.12e-17	84.0	382	0.182	0.144	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
13	Q76K27	5.32e-17	83.2	524	0.195	0.113	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
14	P54751	9.58e-16	78.6	337	0.175	0.157	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
15	Q96JF0	1.05e-15	79.3	529	0.159	0.091	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
16	Q11201	1.46e-15	78.2	340	0.169	0.150	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
17	O43173	3.49e-15	77.4	380	0.215	0.171	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
18	Q64689	4.06e-15	77.0	380	0.215	0.171	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
19	Q02745	2.03e-14	74.7	343	0.166	0.146	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
20	B0CN48	6.39e-14	73.6	374	0.202	0.163	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2.2e-34	130.8	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428540	0.929	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
2	9606.ENSP00000321343	0.924	Alpha-2,8-sialyltransferase 8E
3	9606.ENSP00000377257	0.922	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
4	9606.ENSP00000381008	0.918	Mucin-16
5	9606.ENSP00000484824	0.918	Mucin-1
6	9606.ENSP00000417498	0.916	Mucin-4
7	9606.ENSP00000406861	0.910	Mucin-6
8	9606.ENSP00000414350	0.907	Mucin-20
9	9606.ENSP00000441929	0.904	Mucin-12
10	9606.ENSP00000485028	0.904	Mucin-13
11	9606.ENSP00000485659	0.902	Mucin-5AC
12	9606.ENSP00000436812	0.901	Mucin-5B
13	9606.ENSP00000302716	0.900	Mucin-17
14	9606.ENSP00000311364	0.900	Mucin-like protein 1
15	9606.ENSP00000365473	0.900	Mucin-21
16	9606.ENSP00000368771	0.900	Mucin-3A
17	9606.ENSP00000407422	0.900	Mucin-7
18	9606.ENSP00000416753	0.900	Mucin-15
19	9606.ENSP00000393887	0.815	Alpha-2-HS-glycoprotein
20	9606.ENSP00000356404	0.667	Beta-1,3-galactosyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.816	binding
GO:0005515	0.781	protein binding
GO:0001665	0.732	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0009101	0.989	glycoprotein biosynthetic process
GO:0070085	0.985	glycosylation
GO:0006486	0.983	protein glycosylation
GO:0006629	0.968	lipid metabolic process
GO:0006493	0.944	protein O-linked glycosylation
GO:0016032	0.923	viral process
GO:1903509	0.916	liposaccharide metabolic process
GO:0006643	0.915	membrane lipid metabolic process
GO:0006664	0.876	glycolipid metabolic process
GO:0019080	0.778	viral gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.732	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.732	Transferred entry: 2.4.3.3.

[back to server]