StarFunc result for job id Q9H4G8

User Input

>input (78 residues)
MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYD
KDQFACGETVPVPSVNKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6VUC1	0.858	0.818	7.910E-15	82	0.897	0.854	Q6VUC1.pdb.gz	DPH3_CRIGR Diphthamide biosynthesis protein 3 OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1
2	PDB:2jr7A	0.862	0.805	2.377E-13	84	0.885	0.821	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
3	AFDB:Q21102	0.863	0.843	5.747E-12	80	0.564	0.550	Q21102.pdb.gz	DPH3_CAEEL Diphthamide biosynthesis protein 3 OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=3 SV=1
4	AFDB:Q9UT33	0.813	0.803	9.403E-11	79	0.474	0.468	Q9UT33.pdb.gz	DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph3 PE=3 SV=1
5	AFDB:Q3E840	0.770	0.734	4.769E-9	82	0.359	0.341	Q3E840.pdb.gz	DPH3_YEAST Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI11 PE=1 SV=1
6	PDB:4d4oA	0.743	0.147	4.048E-8	414	0.359	0.068	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
7	AFDB:Q9UUG3	0.670	0.388	2.838E-6	139	0.269	0.151	Q9UUG3.pdb.gz	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
8	AFDB:Q6P3W2	0.659	0.359	8.797E-6	149	0.192	0.101	Q6P3W2.pdb.gz	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
9	PDB:2l6lA	0.547	0.304	2.165E-4	155	0.205	0.103	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
10	AFDB:P47138	0.590	0.290	6.223E-4	172	0.269	0.122	P47138.pdb.gz	DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ3 PE=1 SV=1
11	AFDB:Q388Z0	0.519	0.257	2.355E-3	166	0.308	0.145	Q388Z0.pdb.gz	Q388Z0_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1150 PE=3 SV=1
12	AFDB:Q08288	0.147	0.053	4.832E-1	388	0.141	0.028	Q08288.pdb.gz	LYAR_MOUSE Cell growth-regulating nucleolar protein OS=Mus musculus OX=10090 GN=Lyar PE=1 SV=2
13	AFDB:Q8I5V8	0.234	0.130	7.204E-1	167	0.154	0.072	Q8I5V8.pdb.gz	Q8I5V8_PLAF7 Mago-binding protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1209000 PE=4 SV=1
14	PDB:4btsA9	0.320	0.276	7.270E-1	93	0.103	0.086	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
15	PDB:6ydhA	0.318	0.381	8.876E-1	62	0.103	0.129	6ydhA.pdb.gz
16	PDB:3hi2B	0.165	0.141	1.084	97	0.064	0.052	3hi2B.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
17	PDB:4c2mI	0.275	0.196	1.084	124	0.154	0.097	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
18	PDB:5n5yI	0.299	0.247	1.158	99	0.141	0.111	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
19	PDB:5svah	0.219	0.155	1.512	118	0.064	0.042	5svah.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
20	PDB:6nt6A	0.169	0.076	1.512	278	0.064	0.018	6nt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FX2	2.89e-46	144	82	0.897	0.854	DPH3_HUMAN Diphthamide biosynthesis protein 3 OS=Homo sapiens OX=9606 GN=DPH3 PE=1 SV=1
2	Q6VUC1	3.19e-46	144	82	0.897	0.854	DPH3_CRIGR Diphthamide biosynthesis protein 3 OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1
3	Q8K0W9	7.67e-46	143	82	0.885	0.841	DPH3_MOUSE Diphthamide biosynthesis protein 3 OS=Mus musculus OX=10090 GN=Dph3 PE=1 SV=1
4	Q9UT33	1.41e-21	81.6	79	0.449	0.443	DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph3 PE=3 SV=1
5	Q21102	4.64e-19	75.5	80	0.551	0.537	DPH3_CAEEL Diphthamide biosynthesis protein 3 OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=3 SV=1
6	Q3E840	1.48e-15	66.6	82	0.359	0.341	DPH3_YEAST Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI11 PE=1 SV=1
7	Q9UUG3	2.08e-06	44.3	139	0.282	0.158	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
8	D3YT20	2.45e-06	42.0	43	0.244	0.442	D3YT20_CAEEL DPH3 homolog OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=4 SV=1
9	Q6P3W2	2.57e-04	38.9	149	0.205	0.107	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
10	P47138	0.093	32.0	172	0.244	0.110	DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ3 PE=1 SV=1
11	F1R9L1	0.80	29.6	1078	0.218	0.016	F1R9L1_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=3
12	A0A0R4IMM9	0.95	29.6	1048	0.218	0.016	A0A0R4IMM9_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=1
13	Q8TEQ6	1.9	28.5	1508	0.231	0.012	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
14	Q86BY9	3.2	28.1	1235	0.231	0.015	RIG_DROME Protein rigor mortis OS=Drosophila melanogaster OX=7227 GN=rig PE=1 SV=1
15	P27815	4.5	27.7	886	0.231	0.020	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
16	Q5JV73	5.8	27.3	1810	0.333	0.014	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
17	P34409	7.2	26.9	596	0.218	0.029	POLK_CAEEL DNA polymerase kappa OS=Caenorhabditis elegans OX=6239 GN=polk-1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20137 DUF6527	8.7e+02	11.3	Family of unknown function (DUF6527)
2	PF05876 GpA_ATPase	2.4e+02	12.6	Phage terminase large subunit gpA, ATPase domain
3	PF05207 zf-CSL	3.2e-18	76.5	CSL zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003810879.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008968210.1	0.918	Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
2	9597.XP_003812878.1	0.904	Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2
3	9597.XP_003808531.1	0.873	Diphthamide biosynthesis 5
4	9597.XP_003819315.1	0.818	Eukaryotic translation elongation factor 2
5	9597.XP_003830837.1	0.787	Catalytic tRNA acetyltransferase subunit of the RNA polymerase II elongator complex, which is a component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation
6	9597.XP_008969737.1	0.772	Secretion-regulating guanine nucleotide exchange factor isoform X1
7	9597.XP_003830268.1	0.756	Elongator acetyltransferase complex subunit 2
8	9597.XP_003810938.1	0.725	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
9	9597.XP_003817091.1	0.585	Diphthamide biosynthesis protein 7 isoform X1
10	9597.XP_003830465.1	0.583	DnaJ heat shock protein family (Hsp40) member C24
11	9597.XP_008954125.1	0.583	Elongator acetyltransferase complex subunit 4
12	9597.XP_003816761.1	0.580	Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP
13	9597.XP_003828619.1	0.558	tRNA methyltransferase 112 homolog
14	9597.XP_003805616.1	0.540	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
15	9597.XP_008949908.1	0.518	Oxidoreductase NAD binding domain containing 1
16	9597.XP_008974555.1	0.509	KTI12 chromatin associated homolog
17	9597.XP_003828399.1	0.508	alkB homolog 8, tRNA methyltransferase
18	9597.XP_008974091.1	0.501	Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.897	catalytic activity
GO:0043167	0.455	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.991	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0051246	0.987	regulation of protein metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0031326	0.979	regulation of cellular biosynthetic process
GO:0010608	0.967	post-transcriptional regulation of gene expression
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0006807	0.953	nitrogen compound metabolic process
GO:0034248	0.943	regulation of amide metabolic process
GO:0043170	0.926	macromolecule metabolic process
GO:2000112	0.920	regulation of cellular macromolecule biosynthetic process
GO:0006417	0.902	regulation of translation
GO:0043412	0.892	macromolecule modification
GO:0044237	0.870	cellular metabolic process
GO:0019538	0.857	protein metabolic process
GO:0006448	0.829	regulation of translational elongation
GO:0036211	0.775	protein modification process
GO:0044249	0.528	cellular biosynthetic process
GO:0018193	0.417	peptidyl-amino acid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005654	0.996	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]